Property Summary

NCBI Gene PubMed Count 24
PubMed Score 376.58
PubTator Score 256.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.900 6.7e-07
atypical teratoid/rhabdoid tumor 1.300 4.9e-06
acute quadriplegic myopathy 1.301 4.5e-06
lung cancer 1.200 9.3e-04
posterior fossa group B ependymoma 1.100 2.2e-04
ovarian cancer -1.700 2.8e-08

Protein-protein Interaction (4)

Gene RIF (8)

PMID Text
25712867 NOS-3 overexpression resulted in an increased sensitivity to anti-Fas induced cell death, independently of AR expression and CatD activity.
24321386 These results indicated that abundant FDXR expression in these steroidogenic cells was maintained through SF-1 binding to the intronic enhancer of the FDXR gene
22101253 results suggest that both FDX1 and FDX2 and their likely reductase partner, FDXR, contribute to iron-sulfur cluster biogenesis
20877624 Observational study of gene-disease association. (HuGE Navigator)
18319262 Fhit interaction with ferredoxin reductase triggers generation of reactive oxygen species and apoptosis of cancer cells
12782149 ADXR rate of hydroxylation was linear with incubation time.
12370809 The ferredoxin reductase gene is regulated by the p53 family and sensitizes cells to oxidative stress-induced apoptosis
12137805 comparison of catalytic properties between conditions of limiting and saturating adrenodoxin reductase [cytochrome P450scc]

AA Sequence

MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKHPQAHVDIYEK      1 - 70
QPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVPELREAYHAVVLSYGAEDHRA     71 - 140
LEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALDVARILLTPPEHLERTDITKA    141 - 210
ALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLPGARPILDPVDFLGLQDKIKEVPRPRKRLTELL    211 - 280
LRTATEKPGPAEAARQASASRAWGLRFFRSPQQVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTGDMED    281 - 350
LPCGLVLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQM    351 - 420
LLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLVDPQEMLRLLG    421 - 490
H//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25712867 2015 Sensitivity to anti-Fas is independent of increased cathepsin D activity and adrenodoxin reductase expression occurring in NOS-3 overexpressing HepG2 cells.
24321386 2014 Transcriptional regulation of human ferredoxin reductase through an intronic enhancer in steroidogenic cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22101253 2012 Both human ferredoxins 1 and 2 and ferredoxin reductase are important for iron-sulfur cluster biogenesis.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18319262 2008 Fhit interaction with ferredoxin reductase triggers generation of reactive oxygen species and apoptosis of cancer cells.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12787114 2003 Human skin is a steroidogenic tissue: steroidogenic enzymes and cofactors are expressed in epidermis, normal sebocytes, and an immortalized sebocyte cell line (SEB-1).
12782149 2003 Metabolism of 25-hydroxyvitamin D3 by microsomal and mitochondrial vitamin D3 25-hydroxylases (CYP2D25 and CYP27A1): a novel reaction by CYP27A1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370809 2002 The ferredoxin reductase gene is regulated by the p53 family and sensitizes cells to oxidative stress-induced apoptosis.
12137805 2002 Placental cytochrome P450scc (CYP11A1): comparison of catalytic properties between conditions of limiting and saturating adrenodoxin reductase.
11096094 2001 Oct-1 preferentially interacts with androgen receptor in a DNA-dependent manner that facilitates recruitment of SRC-1.
11053423 2001 Adrenodoxin reductase-adrenodoxin complex structure suggests electron transfer path in steroid biosynthesis.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2969697 1988 Molecular cloning and sequence analysis of human placental ferredoxin.
2845396 1988 Human adrenodoxin reductase: two mRNAs encoded by a single gene on chromosome 17cen----q25 are expressed in steroidogenic tissues.
2790061 1989 Comparison of the immunochemical properties of human placental and bovine adrenal cholesterol side-chain cleavage enzyme complex.
2748461 1989 Immunohistochemical demonstration of adrenodoxin reductase in bovine and human adrenals.
2393675 1990 [Cholesterol-hydroxylating cytochrome P-450 from bovine adrenal cortex mitochondria and human placenta: immunochemical properties and structural characteristics].
2236061 1990 Cloning and sequence of the human adrenodoxin reductase gene.
1917982 1991 Site-specific mutations in human ferredoxin that affect binding to ferredoxin reductase and cytochrome P450scc.
1863359 1991 Regional mapping of genes encoding human steroidogenic enzymes: P450scc to 15q23-q24, adrenodoxin to 11q22; adrenodoxin reductase to 17q24-q25; and P450c17 to 10q24-q25.