Property Summary

NCBI Gene PubMed Count 35
PubMed Score 673.27
PubTator Score 31.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical carcinoma -1.345 1.6e-02
Multiple myeloma 1.269 7.7e-03
ovarian cancer 1.200 3.4e-03
pancreatic ductal adenocarcinoma liver m... -1.698 4.2e-02
ulcerative colitis -1.100 2.3e-05

 GWAS Trait (1)

Gene RIF (16)

AA Sequence

MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVH      1 - 70
FINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDL     71 - 140
AYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS                              141 - 184
//

Text Mined References (40)

PMID Year Title