Property Summary

NCBI Gene PubMed Count 32
PubMed Score 650.77
PubTator Score 31.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.269 7.7e-03
adrenocortical carcinoma -1.345 1.6e-02
pancreatic ductal adenocarcinoma liver m... -1.698 4.2e-02
ulcerative colitis -1.200 3.2e-04
ovarian cancer 1.200 3.4e-03

Protein-protein Interaction (3)

Gene RIF (13)

PMID Text
26431901 TNFSF13 and FDX1 have potential roles in IgAN in the Han Chinese population. This information may be useful in the development of early prognostics for IgAN.
26370181 Did not find any positive association between FDX1 SNPs and the risk of IgA nephropathy after adjustment for age and sex, but did find a significant and strong correlation with relevant clinical pathological parameters.
23435367 results indicate transcription of FDX1 is regulated by the NR5A family and cAMP signaling, and participates in steroid hormone production in ovarian granulosa ce
22101253 Data suggest that interference with any of the three related genes, ferredoxin (FDX)1, FDX2 or FDXR, disrupts iron-sulfur cluster assembly and maintenance of normal cytosolic and mitochondrial iron homeostasis.
21636783 Results present the crystal structure of the complex of human adrenodoxin and CYP11A1--the first of a complex between a eukaryotic CYP and its redox partner.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20689807 Observational study of gene-disease association. (HuGE Navigator)
20547883 Unlike Fdx1, Fdx2 was unable to efficiently reduce mitochondrial cytochromes P450 and convert steroids, indicating that the two ferredoxin isoforms are highly specific for their substrates in distinct biochemical pathways.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17188650 Adx is able to support reactions catalyzed by human microsomal P450s: full length CYP17, truncated CYP17, and truncated CYP21
15927889 Adrenodoxin induces apoptosis by the generation of reactive oxygen species in mitochondria
12782149 ADX rate of hydroxylation was linear with incubation time.

AA Sequence

MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVH      1 - 70
FINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDL     71 - 140
AYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS                              141 - 184
//

Text Mined References (37)

PMID Year Title
26431901 2015 Genetic polymorphisms in TNFSF13 and FDX1 are associated with IgA nephropathy in the Han Chinese population.
26370181 2015 Association between CCDC132, FDX1 and TNFSF13 gene polymorphisms and the risk of IgA nephropathy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23435367 2013 Transcriptional regulation of human ferredoxin 1 in ovarian granulosa cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22101253 2012 Both human ferredoxins 1 and 2 and ferredoxin reductase are important for iron-sulfur cluster biogenesis.
21636783 2011 Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
20547883 2010 Humans possess two mitochondrial ferredoxins, Fdx1 and Fdx2, with distinct roles in steroidogenesis, heme, and Fe/S cluster biosynthesis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17188650 2007 Adrenodoxin supports reactions catalyzed by microsomal steroidogenic cytochrome P450s.
15927889 2005 Adrenodoxin (Adx) and CYP11A1 (P450scc) induce apoptosis by the generation of reactive oxygen species in mitochondria.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12782149 2003 Metabolism of 25-hydroxyvitamin D3 by microsomal and mitochondrial vitamin D3 25-hydroxylases (CYP2D25 and CYP27A1): a novel reaction by CYP27A1.
12699818 2003 Electrochemical behaviour of human adrenodoxin on a pyrolytic graphite electrode.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10899784 2000 Adrenodoxin: structure, stability, and electron transfer properties.
9890963 1999 An additional electrostatic interaction between adrenodoxin and P450c27 (CYP27A1) results in tighter binding than between adrenodoxin and p450scc (CYP11A1).
6270113 1981 Fluorescence energy transfer studies of the interaction between adrenodoxin and cytochrome c.
3872685 1985 [Reconstruction and study of a multi-enzyme system by 11 beta-hydroxylase steroids].
3343244 1988 Human adrenodoxin: cloning of three cDNAs and cycloheximide enhancement in JEG-3 cells.
3339111 1988 Hormonal and developmental regulation of adrenodoxin messenger ribonucleic acid in steroidogenic tissues.
3229285 1988 Cloning and structure of the human adrenodoxin gene.
2969697 1988 Molecular cloning and sequence analysis of human placental ferredoxin.
2340092 1990 Structure, sequence, chromosomal location, and evolution of the human ferredoxin gene family.
1917982 1991 Site-specific mutations in human ferredoxin that affect binding to ferredoxin reductase and cytochrome P450scc.
1909889 1991 1H NMR spectra of vertebrate [2Fe-2S] ferredoxins. Hyperfine resonances suggest different electron delocalization patterns from plant ferredoxins.
1863359 1991 Regional mapping of genes encoding human steroidogenic enzymes: P450scc to 15q23-q24, adrenodoxin to 11q22; adrenodoxin reductase to 17q24-q25; and P450c17 to 10q24-q25.
1429635 1992 Identification by site-directed mutagenesis of two lysine residues in cholesterol side chain cleavage cytochrome P450 that are essential for adrenodoxin binding.