Property Summary

Ligand Count 172
NCBI Gene PubMed Count 54
PubMed Score 876.82
PubTator Score 281.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Protein-protein Interaction (12)

PDB (81)

Gene RIF (29)

AA Sequence

MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRALCSSLRMNGD      1 - 70
QNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKYNRGLTVVVAFRELVEP     71 - 140
RKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRGQICWYQKPGVGLDAINDANLLEACIYRLLK    141 - 210
LYCREQPYYLNLIELFLQSSYQTEIGQTLDLLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAM    211 - 280
YMAGIDGEKEHANAKKILLEMGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQ    281 - 350
ILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK     351 - 419
//

Text Mined References (68)

PMID Year Title