Property Summary

NCBI Gene PubMed Count 19
PubMed Score 38.36
PubTator Score 30.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.700 9.7e-04
Astrocytoma, Pilocytic 1.300 2.0e-04
group 3 medulloblastoma -1.100 4.0e-02
interstitial cystitis 2.400 7.2e-03
medulloblastoma, large-cell 1.600 3.6e-04
nasopharyngeal carcinoma -1.200 4.0e-04
osteosarcoma -1.714 1.2e-05
ovarian cancer 1.400 9.8e-09
periodontitis 1.200 9.4e-22
primary Sjogren syndrome 2.400 3.1e-05
tuberculosis 1.400 9.2e-05
ulcerative colitis 1.200 2.7e-02

Gene RIF (8)

AA Sequence

MKLGCVLMAWALYLSLGVLWVAQMLLAASFETLQCEGPVCTEESSCHTEDDLTDAREAGFQVKAYTFSEP      1 - 70
FHLIVSYDWLILQGPAKPVFEGDLLVLRCQAWQDWPLTQVTFYRDGSALGPPGPNREFSITVVQKADSGH     71 - 140
YHCSGIFQSPGPGIPETASVVAITVQELFPAPILRAVPSAEPQAGSPMTLSCQTKLPLQRSAARLLFSFY    141 - 210
KDGRIVQSRGLSSEFQIPTASEDHSGSYWCEAATEDNQVWKQSPQLEIRVQGASSSAAPPTLNPAPQKSA    211 - 280
APGTAPEEAPGPLPPPPTPSSEDPGFSSPLGMPDPHLYHQMGLLLKHMQDVRVLLGHLLMELRELSGHRK    281 - 350
PGTTKATAE                                                                 351 - 359
//

Text Mined References (20)

PMID Year Title