Property Summary

NCBI Gene PubMed Count 25
PubMed Score 17.27
PubTator Score 21.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
pancreatic cancer 1.300 4.4e-02
osteosarcoma -5.255 5.7e-14
chronic lymphosyte leukemia 2.300 3.9e-07
periodontitis 2.200 9.9e-28
medulloblastoma, large-cell 1.200 2.5e-04
tuberculosis 1.600 1.8e-07
intraductal papillary-mucinous adenoma (... 1.600 4.5e-02
interstitial cystitis 4.500 4.7e-06
lung adenocarcinoma 1.700 1.2e-11
primary Sjogren syndrome 2.000 5.5e-04
pancreatic carcinoma 1.300 4.4e-02
non-small cell lung carcinoma 1.200 5.4e-16
ulcerative colitis 3.700 3.0e-07
ovarian cancer -1.400 4.2e-05
chronic rhinosinusitis 1.328 4.8e-02
cystic fibrosis and chronic rhinosinusit... 2.085 2.2e-03

Gene RIF (15)

PMID Text
25993340 Data suggest that expression of FCRL5 (but not FCRL4) on surface of atypical (perhaps dysfunctional) memory B-Lymphocytes is up-regulated by exposure to Plasmodium falciparum antigens in subjects in Uganda where malaria is endemic.
23616577 FCRL5 is a new type of receptor that recognizes intact IgG, possibly enabling B cells to sense Ig quality. Recognition of undamaged IgG molecules by FCRL5 could allow B cells to engage recently produced Abs.
22491254 FcRL5 binds all immunoglobulin (Ig)G isotypes with varied efficiency.
22028333 Enhanced proliferation and downstream isotype expression upon FCRL5 stimulation could reflect a physiological role for FCRL5 in the expansion and development of antigen-primed B cells.
20626413 Three of the FCRL5 tag SNPs, rs6667109, rs3811035 and rs6692977 showed association with Graves' disease. association with FCRL5 was secondary to linkage disequilibrium with the FCRL3, rs11264798 and rs10489678 SNPs.
20626413 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19775371 Single-nucleotide polymorphism in the FCRL5 gene and HLA-B27 is associated with ankylosing spondylitis.
19775371 Observational study of gene-disease association. (HuGE Navigator)
18802695 Down-regulation of FCRL5 is associated with acute lymphoblastic leukemia.
18704934 Fc receptor-like 1-5 molecules are similarly expressed in progressive and indolent clinical subtypes of B-cell chronic lymphocytic leukemia.
16681430 IRTA2/FcRH5 may have a role in hairy cell leukemia
16439682 results identify FcRH5 as a novel, direct target of EBNA2 that may contribute to the development of Epstein-Barr virus-associated tumors
15671532 IRTA2 is expressed on the surface of human lymphoma cell lines and hairy cell leukemia cells
11929751 Characterization and comparison of the structure and B-cell expression pattern of the entire family of IRTA genes, which includes 5 members contiguously located on chromosome.

AA Sequence

MLLWVILLVLAPVSGQFARTPRPIIFLQPPWTTVFQGERVTLTCKGFRFYSPQKTKWYHRYLGKEILRET      1 - 70
PDNILEVQESGEYRCQAQGSPLSSPVHLDFSSASLILQAPLSVFEGDSVVLRCRAKAEVTLNNTIYKNDN     71 - 140
VLAFLNKRTDFHIPHACLKDNGAYRCTGYKESCCPVSSNTVKIQVQEPFTRPVLRASSFQPISGNPVTLT    141 - 210
CETQLSLERSDVPLRFRFFRDDQTLGLGWSLSPNFQITAMWSKDSGFYWCKAATMPYSVISDSPRSWIQV    211 - 280
QIPASHPVLTLSPEKALNFEGTKVTLHCETQEDSLRTLYRFYHEGVPLRHKSVRCERGASISFSLTTENS    281 - 350
GNYYCTADNGLGAKPSKAVSLSVTVPVSHPVLNLSSPEDLIFEGAKVTLHCEAQRGSLPILYQFHHEGAA    351 - 420
LERRSANSAGGVAISFSLTAEHSGNYYCTADNGFGPQRSKAVSLSVTVPVSHPVLTLSSAEALTFEGATV    421 - 490
TLHCEVQRGSPQILYQFYHEDMPLWSSSTPSVGRVSFSFSLTEGHSGNYYCTADNGFGPQRSEVVSLFVT    491 - 560
VPVSRPILTLRVPRAQAVVGDLLELHCEAPRGSPPILYWFYHEDVTLGSSSAPSGGEASFNLSLTAEHSG    561 - 630
NYSCEANNGLVAQHSDTISLSVIVPVSRPILTFRAPRAQAVVGDLLELHCEALRGSSPILYWFYHEDVTL    631 - 700
GKISAPSGGGASFNLSLTTEHSGIYSCEADNGLEAQRSEMVTLKVAVPVSRPVLTLRAPGTHAAVGDLLE    701 - 770
LHCEALRGSPLILYRFFHEDVTLGNRSSPSGGASLNLSLTAEHSGNYSCEADNGLGAQRSETVTLYITGL    771 - 840
TANRSGPFATGVAGGLLSIAGLAAGALLLYCWLSRKAGRKPASDPARSPSDSDSQEPTYHNVPAWEELQP    841 - 910
VYTNANPRGENVVYSEVRIIQEKKKHAVASDPRHLRNKGSPIIYSEVKVASTPVSGSLFLASSAPHR       911 - 977
//

Text Mined References (28)

PMID Year Title
25993340 2015 FCRL5 Delineates Functionally Impaired Memory B Cells Associated with Plasmodium falciparum Exposure.
23616577 2013 Human Fc receptor-like 5 binds intact IgG via mechanisms distinct from those of Fc receptors.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
22491254 2012 Cutting edge: human FcRL4 and FcRL5 are receptors for IgA and IgG.
22044751 2011 Heritability and genome-wide association analysis of renal sinus fat accumulation in the Framingham Heart Study.
22028333 2012 Fc receptor-like 5 promotes B cell proliferation and drives the development of cells displaying switched isotypes.
20626413 2010 Association of Fc receptor-like 5 (FCRL5) with Graves' disease is secondary to the effect of FCRL3.
20590663 2010 Expression phenotype changes of EBV-transformed lymphoblastoid cell lines during long-term subculture and its clinical significance.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19775371 2009 A single-nucleotide polymorphism marker within the FCRL5 gene and HLA-B27 positive Han Chinese ankylosing spondylitis patients.
18802695 2009 Low representation of Fc receptor-like 1-5 molecules in leukemic cells from Iranian patients with acute lymphoblastic leukemia.
18704934 2008 Fc receptor-like 1-5 molecules are similarly expressed in progressive and indolent clinical subtypes of B-cell chronic lymphocytic leukemia.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17273841 2007 The first avian Ig-like Fc receptor family member combines features of mammalian FcR and FCRL.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16849395 2006 Expression pattern of the human FcRH/IRTA receptors in normal tissue and in B-chronic lymphocytic leukemia.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16681430 2006 Sandwich ELISAs for soluble immunoglobulin superfamily receptor translocation-associated 2 (IRTA2)/FcRH5 (CD307) proteins in human sera.
16439682 2006 Epstein-Barr virus nuclear antigen 2 induces FcRH5 expression through CBF1.
15671532 2005 Immunoglobulin superfamily receptor translocation associated 2 protein on lymphoma cell lines and hairy cell leukemia cells detected by novel monoclonal antibodies.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11929751 2002 IRTAs: a new family of immunoglobulinlike receptors differentially expressed in B cells.
11493702 2001 Identification of a family of Fc receptor homologs with preferential B cell expression.
11453668 2001 BXMAS1 identifies a cluster of homologous genes differentially expressed in B cells.
11290337 2001 IRTA1 and IRTA2, novel immunoglobulin superfamily receptors expressed in B cells and involved in chromosome 1q21 abnormalities in B cell malignancy.
11027651 2000 Altered gene expression upon BCR cross-linking in Burkitt's lymphoma B cell line.