1. Home
  2. Targets
  3. cell adhesion molecule
  4. Fc receptor-like protein 3

Tbio Fc receptor-like protein 3

This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains immunoreceptor-tyrosine activation motifs and immunoreceptor-tyrosine inhibitory motifs in its cytoplasmic domain and may play a role in regulation of the immune system. Mutations in this gene have been associated with rheumatoid arthritis, autoimmune thyroid disease, and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]

 Comments

Property Summary

NCBI Gene PubMed Count 80
PubMed Score 68.92
PubTator Score 103.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Thyrotoxicosis 38 0.0 2.0
Type 1 diabetes mellitus 104 0.0 2.0
Disease Target Count
Rheumatoid Arthritis 1170

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -3.853 3.3e-05
interstitial cystitis 3.700 4.6e-03
primary Sjogren syndrome 2.700 3.7e-04
nasopharyngeal carcinoma -1.500 1.9e-02
ductal carcinoma in situ 1.300 4.3e-02
ulcerative colitis 1.900 8.5e-03
psoriasis 2.400 1.1e-30

Synonym

Accession Q96P31 A0N0M4 A8MTH7 D3DVD2 Q5VXZ8 Q8N6S2 Q96LA4 Q96P27 Q96P28 Q96P29 Q96P30 FcR-like protein 3
Symbols FCRH3
IFGP3
IRTA3
SPAP2
CD307c

Gene

FCRL3

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (15)

See all...

 GO Component (2)

 Compartment GO Term (10)

 GWAS Trait (3)

 HCA RNA Cell Line (13)

See all...

 CSPA Cell Line (4)

Pathway (1)

Protein-protein Interaction (1)

HSPA8  

Gene RIF (93)

PMID Text
26994388 CTLA4 and FCRL3 genes overexpression may play an important role in children suffering from autoimmune thyroiditis.
26746625 genetic polymorphism is associated with rheumatoid arthritis in Chinese Han population
26402798 4 Single Nucleotide Polymorphisms (rs7528684, rs945635, rs3761959, and rs2282284) could significantly elevate the risk of Neuromyelitis Optica in Chinese Han population.
26334889 FCRL3 genetic polymorphisms were associated with an increased risk of endometriosis-related infertility, regardless of symptoms.
26321232 FCRL3_3, FCRL3_5 and FCRL3_6 polymorphisms could increase susceptibility to Graves' disease only in Asians, rather than in Caucasians.
26051414 Association between FCRL3 polymorphisms and increased risk of sudden sensorineural hearing loss in a Chinese Han population.
25762785 the TIGIT/FCRL3 combination allows reliable identification of Helios(+) Treg cells even in highly activated conditions in vitro as well as in PBMCs of autoimmune patients.
25594855 study found a significant association between the SNPs in FCRL3 gene and allergic rhinitis (AR) in Chinese Han patients; results suggest these gene polymorphisms might be the autoimmunity risk for AR
25575677 Genetic polymorphisms in FCRL3 are genetic risk factors for neuromyelitis optica in the Chinese population.
24593204 CONCLUSIONS: Our study demonstrated that the FCRL3 -169T>C polymorphism is not a risk factor of systemic lupus erythematosus in the Polish population, but this polymorphism may contribute to autoantibody production in this disease.
24117236 the FCRL3 polymorphisms are associated with not only autoimmune diseases including RA, GD, T1D, and other disease under different genetic models, but also different ethnic subgroups.
23883198 The results of this study showed a significant association between FCRL3-110 A/G polymorphism and susceptibility to rheumatoid arthritis.
23857366 FCRL3 amplified the NF-kappaB and mitogen-activated protein kinase signaling cascades, and halted CpG triggered BLIMP1 induction in an ERK-dependent fashion.
23777926 This meta-analysis demonstrates that the FCRL3 -169 C/T polymorphism may confer susceptibility to seropositive RA in Asians.[meta-analysis]
23553198 FCRL3 -169T>C polymorphism alters the expression of FCRL3 and can be a risk factor of endometriosis-related infertility.
23512175 meta-analysis of published studies including 2,544 patients and 3,913 controls demonstrates that the FCRL3 -169 C/T polymorphism does not confer susceptibility to systemic lupus erythematosus in Europeans or Asians
23505439 FCRL3 gene and its proxy SNP rs7528684 may be involved in the pathogenesis of GD by excessive inhibiting B cell receptor signaling and the impairment of suppressing function of Tregs.
23463945 FCRL3 gene polymorphism shows positive relatationship in the development of rheumatoid arthritis.
23070121 A male-gender juvenile rheumatoid arthritis and asthma, but not childhood-onset systemic lupus erythematosus are associated with FCRL3 polymorphisms in Mexicans.
22706687 CD40 and FCRL3 gene polymorphisms were associated with autoimmune hyperthyroidism intractability.
22458979 Frequencies of specific FcRL3 haplotypes are significantly associated with a Chinese cohort of Guillain-Barre syndrome patients compared with healthy controls.
22392608 A functional variant in FCRL3 is associated with higher Fc receptor-like 3 expression on T cell subsets and rheumatoid arthritis disease activity.
22386693 Polymorphisms of the FCRL3 gene may contribute to the progression of joint destruction rather than susceptibility to rheumatoid arthritis.
22341374 Findings support a possible gene-gene interaction for FOXP3/FCRL3 polymorphisms, leading to a cumulative effect on endometriosis development.
21885492 FCRL3 -169C/C genotype is associated with anti-citrullinated protein antibody-positive rheumatoid arthritis and with radiographic progression.
21663782 genetic polymorphism is associated with endometriosis in Brazilian population
21529967 the FCRL3 C-169T polymorphism may play an important role in the pathogenesis of endometriosis and/or infertility.
21299530 A significant association of fcrl3_3 with primary biliary cirrhosis only in Japanese.
21078711 The functional FCRL3 SNP -169T/C appears to play important roles in the development of certain phenotypes such as systemic lupus erythematosus leukopenia and rheumatoid arthritis disease severity in Taiwanese patients with these diseases.
21078711 Observational study of gene-disease association. (HuGE Navigator)
20732364 These results suggest that FCRL3 polymorphisms and haplotypes may contribute to genetic susceptibility to rheumatoid arthritis in a Chinese population.
20732364 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20190142 FcRL3 expression is associated with T(reg) dysfunction
19953494 The polymorphisms of the promoter A/G,exon 2 C/G,exon 4 C/T in the FcRL3 gene were risk factors to Graves disease in Chongqing Han population.
19953494 Observational study of gene-disease association. (HuGE Navigator)
19877046 The FCRL3 -169CT promoter single-nucleotide polymorphism, which is associated with systemic lupus erythematosus in a Japanese population, predicts expression of receptor protein on CD19+B cells.
19843936 Augmented inhibition of BCR-mediated signaling by FCRL3 with the disease-risk genotype alter the activation threshold and promote tolerance breakdown in B cells.
19690864 Meta-analysis suggests that the FCRL3 -169 C/T polymorphism is a significant risk factor for rheumatoid arthritis in Asians, but not in Europeans.
19690864 Meta-analysis of gene-disease association. (HuGE Navigator)
19657722 The FCRL3 gene does not appear associated with susceptibility to HLA-B27-positive ankylosing spondylitis in Han Chinese population.
19657722 Observational study of gene-disease association. (HuGE Navigator)
19605748 functional variants in FCRL3, SLC22A4 and MHC2TA do not show a convincing effect on RA susceptibility in the United Kingdom.
19605748 Observational study of gene-disease association. (HuGE Navigator)
19565352 This meta-analysis demonstrates that the FCRL3 169CC genotype (recessive effect) may confer susceptibility to systemic lupus erythematosus, especially in Asian-derived population.
19565352 Meta-analysis of gene-disease association. (HuGE Navigator)
19494275 FCRL3 may be involved in human-specific mechanisms to control the generation of nTreg cells
19452015 Our study confirms the previous association of HLA-DR4 and HLA-DRw53 with Vogt-Koyanagi-Harada(VKH) syndrome but fails to demonstrate an association between FCRL3 polymorphisms and VKH syndrome.
19438904 PTPN22 rs3789604 and FCRL3 rs7528684 polymorphisms are protective against Graves' disease.
19235910 FcRL3 gene promoter variant is associated with peripheral arthritis in Crohn's disease.
19235910 Observational study of gene-disease association. (HuGE Navigator)
19158815 Observational study of gene-disease association. (HuGE Navigator)
19050767 The -110 G allele and haplotype CGCG of FCRL3 are positively associated with Behcet's disease(BD) in Chinese population. Haplotype ATCG might be protective haplotype for BD.
19050767 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18704934 Fc receptor-like 1-5 molecules are similarly expressed in progressive and indolent clinical subtypes of B-cell chronic lymphocytic leukemia.
18556175 Genetic variations in FCRL3 were not associated with systemic lupus erythematosus in Chinese population.
18556175 Observational study of gene-disease association. (HuGE Navigator)
18313765 Two SNPs (rs7528684/FCRL3_3 and rs7522061/N28D), which were in high linkage disequilibrium (r(2) = 0.87), differed between MS cases and controls.
18313765 Observational study of gene-disease association. (HuGE Navigator)
18087673 FCRL3 gene single nucleotide polymorphism was associated with rheumatoid arthritis
18087673 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18065500 RA was associated with the C allele (odds ratio (OR) = 1.16, 95% CI 1.01 to 1.33) and the CC genotype (OR = 1.30, 95% CI 1.01 to 1.67) of the FCRL3 -169T>C SNP. Clinical subgroup analysis indicated that this was connected to the polyarticular subgroup.
18065500 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17961971 we found suggestive evidence for association of the FCRL3 -169CC genotype, corresponding to the susceptibility genotype for rheumatoid arthritis
17961971 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17868046 Observational study of gene-disease association. (HuGE Navigator)
17763442 results of these meta-analyses provide no evidence that the FCRL3 -169TC polymorphism plays a significant role in determining rheumatoid arthritis risk in whites of European descent
17617473 Observational study of gene-disease association. (HuGE Navigator)
17617473 An increased susceptibility associated to the -169 T allele was found when MS patients.
17389014 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17389014 there is an epistatic interaction between genes in chromosomes 6p21 and 1q21-22, marked, respectively, by HLA-DRB1*0103 and FCRL3-169 AG
17389014 The FCRL3 gene is involved in inflammatory bowel disease (IBD) genetic susceptibility by an epistatic interaction with HLA-DRB1*0103.
17200162 Observational study of gene-disease association. (HuGE Navigator)
17200162 Susceptibility to autoimmunity at the FCRL3 locus.
17179172 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17154080 Observational study of gene-disease association. (HuGE Navigator)
17133581 Observational study of gene-disease association. (HuGE Navigator)
17133581 The association of the -169C/T SNP in FCRL3 with rheumatoid arthritis and systemic lupus erythematosus that was observed in Japanese patients was not replicated in a Korean population.
17133579 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17133579 Both the FCRL3 and PTPN22 genes play roles in rheumatoid arthritis susceptibility, but in different individuals.
17117947 Observational study of gene-disease association. (HuGE Navigator)
17117947 Findings from a large case-control sample of patients with alopecia areata (AA) do not support an association between FCRL3 and susceptibility to AA.
17020818 Observational study of gene-disease association. (HuGE Navigator)
17020818 Susceptibility to type 1 autoimmune hepatitis in Japanese patients is not influenced by FcgammaRIIA, FcgammaRIIB, or FCRL3 polymorphisms.
16911635 Observational study of gene-disease association. (HuGE Navigator)
16859508 Observational study of gene-disease association. (HuGE Navigator)
16859508 This gene will not have a substantial effect in determining susceptibility to RArheumatoid arthritis in populations of Northern European descent.
16519819 Observational study of gene-disease association. (HuGE Navigator)
16476711 Observational study of gene-disease association. (HuGE Navigator)
16384851 Observational study of gene-disease association. (HuGE Navigator)
16384851 Single nucleotide polymorphism in Graves' disease in a large UK Caucasian Graves' disease data set.
16176992 Observational study of gene-disease association. (HuGE Navigator)
12051764 molecular cloning and characterization of SPAP2

AA Sequence 

MLLWLLLLILTPGREQSGVAPKAVLLLNPPWSTAFKGEKVALICSSISHSLAQGDTYWYHDEKLLKIKHD      1 - 70
KIQITEPGNYQCKTRGSSLSDAVHVEFSPDWLILQALHPVFEGDNVILRCQGKDNKNTHQKVYYKDGKQL     71 - 140
PNSYNLEKITVNSVSRDNSKYHCTAYRKFYILDIEVTSKPLNIQVQELFLHPVLRASSSTPIEGSPMTLT    141 - 210
CETQLSPQRPDVQLQFSLFRDSQTLGLGWSRSPRLQIPAMWTEDSGSYWCEVETVTHSIKKRSLRSQIRV    211 - 280
QRVPVSNVNLEIRPTGGQLIEGENMVLICSVAQGSGTVTFSWHKEGRVRSLGRKTQRSLLAELHVLTVKE    281 - 350
SDAGRYYCAADNVHSPILSTWIRVTVRIPVSHPVLTFRAPRAHTVVGDLLELHCESLRGSPPILYRFYHE    351 - 420
DVTLGNSSAPSGGGASFNLSLTAEHSGNYSCDADNGLGAQHSHGVSLRVTVPVSRPVLTLRAPGAQAVVG    421 - 490
DLLELHCESLRGSFPILYWFYHEDDTLGNISAHSGGGASFNLSLTTEHSGNYSCEADNGLGAQHSKVVTL    491 - 560
NVTGTSRNRTGLTAAGITGLVLSILVLAAAAALLHYARARRKPGGLSATGTSSHSPSECQEPSSSRPSRI    561 - 630
DPQEPTHSKPLAPMELEPMYSNVNPGDSNPIYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHP    631 - 700
DDSAGEASSRGRAHEEDDEENYENVPRVLLASDH                                        701 - 734
//

Text Mined References (85)

PMID Year Title
26994388 2016 In children with autoimmune thyroiditis CTLA4 and FCRL3 genes--but not PTPN22--are overexpressed when compared to adults.
26746625 2016 FCRL3 gene polymorphisms as risk factors for rheumatoid arthritis.
26402798 2015 The Fc Receptor-Like 3 Polymorphisms (rs7528684, rs945635, rs3761959 and rs2282284) and The Risk of Neuromyelitis Optica in A Chinese Population.
26334889 2015 Association of FCRL3 Genetic Polymorphisms With Endometriosis-Related Infertility Risk: An Independent Study in Han Chinese.
26321232 2016 Genetic association of Fc receptor-like glycoprotein with susceptibility to Graves' disease in a Chinese Han population.
26051414 2015 FCRL3 gene polymorphisms confer risk for sudden sensorineural hearing loss in a Chinese Han Population.
25762785 2015 Coexpression of TIGIT and FCRL3 identifies Helios+ human memory regulatory T cells.
25594855 2015 FCRL3 gene polymorphisms confer autoimmunity risk for allergic rhinitis in a Chinese Han population.
25575677 2016 Significant Association Between Fc Receptor-Like 3 Polymorphisms (-1901A>G and -658C>T) and Neuromyelitis Optica (NMO) Susceptibility in the Chinese Population.
24593204 2014 The FCRL3 -169T>C polymorphism might be associated with some autoantibody presence in patients with SLE in a Polish population.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24117236 2013 The Fc receptor-like 3 gene polymorphisms and susceptibility to autoimmune diseases: an updated meta-analysis.
23883198 2013 Association of FCRL3 genotypes with susceptibility of Iranian patients to rheumatoid arthritis.
23857366 2013 FCRL3 promotes TLR9-induced B-cell activation and suppresses plasma cell differentiation.
23777926 2013 Association between functional Fc receptor-like 3 (FCRL3) -169 C/T polymorphism and susceptibility to seropositive rheumatoid arthritis in Asians: a meta-analysis.
23553198 2013 The FCRL3 -169T>C polymorphism and the risk of endometriosis-related infertility in a Polish population.
23512175 2013 Fc receptor-like 3 (FCRL3) -169 C/T polymorphism and systemic lupus erythematosus: a meta-analysis.
23505439 2013 A refined study of FCRL genes from a genome-wide association study for Graves' disease.
23463945 2013 An updated meta-analysis of the Fc receptor-like 3 -169T/C polymorphism and rheumatoid arthritis risk.
23070121 2013 Juvenile rheumatoid arthritis and asthma, but not childhood-onset systemic lupus erythematosus are associated with FCRL3 polymorphisms in Mexicans.
22706687 2012 Associations between autoimmune thyroid disease prognosis and functional polymorphisms of susceptibility genes, CTLA4, PTPN22, CD40, FCRL3, and ZFAT, previously revealed in genome-wide association studies.
22458979 2012 Fc receptor like 3 in Chinese patients of Han nationality with Guillain-Barré syndrome.
22392608 2012 A functional variant in FCRL3 is associated with higher Fc receptor-like 3 expression on T cell subsets and rheumatoid arthritis disease activity.
22386693 2012 FCRL3 gene polymorphisms contribute to the radiographic severity rather than susceptibility of rheumatoid arthritis.
22341374 2012 Genetic association study of polymorphisms FOXP3 and FCRL3 in women with endometriosis.
21885492 2011 FCRL3 -169C/C genotype is associated with anti-citrullinated protein antibody-positive rheumatoid arthritis and with radiographic progression.
21841780 2011 A genome-wide association study identifies two new risk loci for Graves' disease.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21829393 2011 Genome-wide association analysis of autoantibody positivity in type 1 diabetes cases.
21663782 2011 Association of FCRL3 -169T/C polymorphism with endometriosis and identification of a protective haplotype against the development of the disease in Brazilian population.
21529967 2011 Association of FCRL3 C-169T promoter single-nucleotide polymorphism with idiopathic infertility and infertility-related endometriosis.
21299530 2011 Genetic association of Fc receptor-like 3 polymorphisms with susceptibility to primary biliary cirrhosis: ethnic comparative study in Japanese and Italian patients.
21078711 2011 Disease phenotypes and gender association of FCRL3 single-nucleotide polymorphism -169T/C in Taiwanese patients with systemic lupus erythematosus and rheumatoid arthritis.
20732364 2010 Fc receptor-like 3 gene polymorphisms confer susceptibility to rheumatoid arthritis in a Chinese population.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20190142 2010 Expression of the autoimmune susceptibility gene FcRL3 on human regulatory T cells is associated with dysfunction and high levels of programmed cell death-1.
19953494 2009 [Study on the association of 3 SNPs of FcRL3 gene with Graves disease in Chongqing Han population].
19877046 2009 The FCRL3-169CT promoter single-nucleotide polymorphism, which is associated with systemic lupus erythematosus in a Japanese population, predicts expression of receptor protein on CD19+ B cells.
19843936 2009 FCRL3, an autoimmune susceptibility gene, has inhibitory potential on B-cell receptor-mediated signaling.
19690864 2010 Fc receptor-like 3 -169 C/T polymorphism and RA susceptibility: a meta-analysis.
19657722 2010 No significant association between Fc receptor-like 3 gene polymorphisms and human leukocyte antigen-B27 positive ankylosing spondylitis in Han Chinese population.
19605748 2009 A re-evaluation of three putative functional single nucleotide polymorphisms in rheumatoid arthritis.
19565352 2010 Association between Fc receptor-like 3 C169T polymorphism and risk of systemic lupus erythematosus: a meta-analysis.
19494275 2009 Fc receptor-like 3 protein expressed on IL-2 nonresponsive subset of human regulatory T cells.
19452015 2009 Polymorphisms of FCRL3 in a Chinese population with Vogt-Koyanagi-Harada (VKH) syndrome.
19438904 2010 Clinical associations of the genetic variants of CTLA-4, Tg, TSHR, PTPN22, PTPN12 and FCRL3 in patients with Graves' disease.
19235910 2009 FcRL3 gene promoter variant is associated with peripheral arthritis in Crohn's disease.
19158815 2009 Two-stage case-control association study of polymorphisms in rheumatoid arthritis susceptibility genes with schizophrenia.
19050767 2008 Association between polymorphisms of FCRL3, a non-HLA gene, and Behçet's disease in a Chinese population with ophthalmic manifestations.
18704934 2008 Fc receptor-like 1-5 molecules are similarly expressed in progressive and indolent clinical subtypes of B-cell chronic lymphocytic leukemia.
18556175 2008 Lack of association between Fc receptor-like 3 gene polymorphisms and systemic lupus erythematosus in Chinese population.
18313765 2008 The high producer variant of the Fc-receptor like-3 (FCRL3) gene is involved in protection against multiple sclerosis.
18087673 2008 Replication of reported genetic associations of PADI4, FCRL3, SLC22A4 and RUNX1 genes with rheumatoid arthritis: results of an independent Japanese population and evidence from meta-analysis of East Asian studies.
18065500 2008 The FCRL3 -169T>C polymorphism is associated with rheumatoid arthritis and shows suggestive evidence of involvement with juvenile idiopathic arthritis in a Scandinavian panel of autoimmune diseases.
17961971 2008 FCRL3 -169CT functional polymorphism in type 1 diabetes and autoimmunity traits.
17952073 2007 Association scan of 14,500 nonsynonymous SNPs in four diseases identifies autoimmunity variants.
17868046 2007 Association of autoimmune disease-related gene polymorphisms with chronic graft-versus-host disease.
17763442 2007 Meta-analysis evidence of a differential risk of the FCRL3 -169T-->C polymorphism in white and East Asian rheumatoid arthritis patients.
17617473 2007 FcRL3 and multiple sclerosis pathogenesis: role in autoimmunity?
17389014 2007 Epistatic interaction between FCRL3 and MHC in Spanish patients with IBD.
17273841 2007 The first avian Ig-like Fc receptor family member combines features of mammalian FcR and FCRL.
17200162 2007 Analysis of the Fc receptor-like-3 (FCRL3) locus in Caucasians with autoimmune disorders suggests a complex pattern of disease association.
17179172 2007 FCRL3 promoter 169 CC homozygosity is associated with susceptibility to rheumatoid arthritis in Dutch Caucasians.
17154080 2006 [Susceptibility genes for the development of autoimmune thyroid disease].
17133581 2006 The -169C/T polymorphism in FCRL3 is not associated with susceptibility to rheumatoid arthritis or systemic lupus erythematosus in a case-control study of Koreans.
17133579 2006 Rheumatoid arthritis association with the FCRL3 -169C polymorphism is restricted to PTPN22 1858T-homozygous individuals in a Canadian population.
17117947 2006 Investigation of the functional variant c.-169T > C of the Fc receptor-like 3 (FCRL3) gene in alopecia areata.
17020818 2007 Lack of association between FCRL3 and FcgammaRII polymorphisms in Japanese type 1 autoimmune hepatitis.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16911635 2006 The functional variant -169C/T in the FCRL3 gene does not increase susceptibility to Type 1 diabetes.
16859508 2006 Association of the FCRL3 gene with rheumatoid arthritis: a further example of population specificity?
16849395 2006 Expression pattern of the human FcRH/IRTA receptors in normal tissue and in B-chronic lymphocytic leukemia.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16519819 2006 Analysis of polymorphisms in 16 genes in type 1 diabetes that have been associated with other immune-mediated diseases.
16476711 2006 Epistatic interaction between FCRL3 and NFkappaB1 genes in Spanish patients with rheumatoid arthritis.
16384851 2006 Contribution of single nucleotide polymorphisms within FCRL3 and MAP3K7IP2 to the pathogenesis of Graves' disease.
16176992 2006 Supportive evidence for a genetic association of the FCRL3 promoter polymorphism with rheumatoid arthritis.
15838509 2005 A functional variant in FCRL3, encoding Fc receptor-like 3, is associated with rheumatoid arthritis and several autoimmunities.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12051764 2002 SPAP2, an Ig family receptor containing both ITIMs and ITAMs.
12014205 2002 Fc receptor homologs (FcRH1-5) extend the Fc receptor family.
11929751 2002 IRTAs: a new family of immunoglobulinlike receptors differentially expressed in B cells.
11493702 2001 Identification of a family of Fc receptor homologs with preferential B cell expression.