Property Summary

NCBI Gene PubMed Count 80
PubMed Score 191.02
PubTator Score 133.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.051 8.5e-05
pancreatic ductal adenocarcinoma liver m... -3.058 5.5e-04
aldosterone-producing adenoma -1.398 1.8e-02
pituitary cancer -1.300 6.1e-06
psoriasis -1.500 1.2e-07

Gene RIF (72)

PMID Text
26464189 association of FCN2 polymorphisms with nephritis and severe cumulative damage in SLE patients; no association with rheumatoid arthritis development
26379154 -557 A>G, -64 A>C and +6424 G>T SNPs of the FCN2 gene were correlated with pulmonary TB.
26207622 FCN2 and MBL2 allele frequencies were similarly distributed in early and late age-related macular degeneration cases compared with controls
26074063 this study provide novel insight in the binding and complement activating capacity of the lectin pathway initiation molecules ficolin-2 and ficolin-3 towards relevant Gram-negative pathogens of pathophysiological relevance.
25965808 Findings indicate the FCN2 variant +6359C>T is associated with the occurrence of visceral leishmaniasis and that ficolin-2 serum levels are elevated in Leishmania infections.
25612732 L-ficolin modulates the immune response to A. fumigatus.
25447524 binding of ficolin-2 to sulfated/phosphated carbohydrates
25344472 paper identifies phosphocholine moieties of pneumococcal teichoic acid as a novel L-ficolin ligand
25251245 CVID patients with bronchiectasis have very low levels of ficolin-2. The reason for the deficiency of ficolin-2 in CVID and any possible causal relationship is currently unknown.
25174443 Ficolin-2 was depleted from plasma during cardiac surgery when using heparin-coated bypass circuits and did not reach baseline level 24 h postoperation.
25083730 There is lack of association of serum mannose-binding lectin or ficolins with complement activation in patients with antiphospholipid antibodies.
25069872 This study aims to investigate whether an association exists between the ficolins that are part of the lectin complement pathway and systemic lupus erythematosus.
25024112 MBL deficiency or MBL2 and FCN2 mutations were not associated with an improved hepatitis B vaccine response in Kenyan HIV-1 uninfected individuals.
24928988 Data suggest that the hepatitis C virus (HCV) entry inhibitor ficolin-2 is an antiviral innate immune molecule, whereas apolipoprotein E3 (ApoE3) blocks the effect of ficolin-2 and mediates an immune escape mechanism during chronic HCV infection.
24854201 hepatitis c virus entry inhibitor
24736883 Very low serum ficolin-2 levels were associated with higher risk of 30-day mortality in community-acquired pneumonia patients.
24683196 Ficolin-2 mediates serum protection by recognizing specific O-acetylated epitopes of pneumococcal capsule polysaccharides.
24486561 MBL2 and FCN2 genotypic variants were analyzed for association with the incidence of acute rejection within the first year after kidney transplantation.
24453114 FCN2 polymorphisms for promoter regions -986, -602, -557, -64, -4 and exon 8 regions +6,359, +6,424 were determined in children with B-ALL. Medium/high-risk haplotype were associated with prolonged duration of febrile neutropenia and bacterial infections.
24227370 results show that SNPS in FCN2 are significantly more susceptible to infectious complications, SIRS and septic shock.
24182802 bloodstream infections collected prospectively were associated with MBL2 and FCN2 genotypic variants over the first year after kidney transplantation
24040095 Ficolin-2 defends against virulent Mycobacteria tuberculosis infection in vivo, and its insufficiency is associated with infection in humans.
23911396 Data indicate that Ficolin-2 blood concentration dependents on sampling procedures.
23744477 Data indicate that in contrast to serum level, the expression of Ficolin-2 (FCN2) was significantly lower in ovarian cancer (OC).
23619474 this study reports for thefirst time the relationship between full FCN2 genotypes and serumprotein concentrations and discuss the relevance of these findings fordisease association studies
23593180 Patients with chronic Chagas disease presented with decreased L-ficolin plasma levels that were associated with the 258S polymorphism.
23525825 Variant FCN2 gene alleles of -64 and +6424 (in strong linkage disequlibrium) are known to be associated with low L-ficolin level or activity.
23423485 the expected positive association of complement genes with leprosy susceptibility and clinical outcomes in Han Chinese.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of ficolin (collagen/fibrinogen domain containing lectin) 2 (FCN2) in peptide-treated PBMCs
23298162 Our findings suggest that early increased ficolin-2 is highly correlated with hepatic inflammation and rapid viral response.
22892990 Ficolin-2 Ala258Ser polymorphism in the donor independently predicts improved graft outcome.
22693230 These findings demonstrate that FCN2 promoter variants (-986G>A and -4A>G) influence ficolin-2 serum levels and susceptibility to schistosomiasis.
22670778 The purpose of this study was to determine whether circulating levels of ficolin-2 and ficolin-3 are altered in normal pregnancy and pre-eclampsia.
22594803 The genotype distribution of three functional SNP variants (-986 G > A, -602 G > A and -4A > G) of ficolin 2 differed significantly between the white, black, and Asian groups. The SNP variants were highly linked to each other.
22457818 results provide a basis for a future study that could confirm or disprove possible relationships between FCN2 gene polymorphisms with cutaneous leishmaniasis
22350641 The association between L-ficolin and thrombocytopenia suggests a pathogenic role for L-ficolin in thrombocytopenia in systemic lupus erythematosus.
22173059 Data show no association of donor and recipient MBL2 and MASP2 genotype with allograft outcome, and analysis of SNPs and haplotypes in the FCN2 gene of the donor and recipient did not reveal an association with transplant outcome.
22140517 The very first study on Vietnamese cohort associates both Ficolin-2 serum levels and FCN2 haplotypes to hepatitis B virus infection and subsequent disease progression.
22082351 Cord blood MBL concentrations were significantly lower in intrauterine-growth-restriction (IUGR) cases than controls. No differences in H- and L-ficolin concentrations were observed between groups.
21334396 MBL2 and FCN2 risk alleles of donor liver and recipient constitute independent risk factors for cytomegalovirus infection after orthotopic liver transplantation.
21327568 deposited in skin lesions of pemphigus
20937340 No FCN2 promoter haplotypes were significantly distributed between mild and severe malaria cases
20937340 Observational study of gene-disease association. (HuGE Navigator)
20682603 FCN2 polymorphisms in patients on peritoneal dialysis is associated with staphylococcal peritonitis.
20682603 Observational study of gene-disease association. (HuGE Navigator)
20593422 Donor and recipient gene polymorphisms in the lectin complement pathway (MBL2, FCN2, MASP2) are major determinants of the risk of clinically significant bacterial infection and mortality after orthotopic liver transplantation.
20593422 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19767106 L-ficolin may confer some protection from microorganisms that exacerbate allergic inflammation in the lung and its relative deficiency may contribute to enhanced susceptibility to respiratory infections.
19728924 increased serum levels in patients with hepatitis C virus
19664148 Observational study of gene-disease association. (HuGE Navigator)
19632990 These results demonstrate that PTX3 and Ficolin-2 may recruit each other on pathogens.
19434912 Distribution of functional FCN2 haplotypes amongpatients is significant different from that among the control subjects.
19434912 Observational study of gene-disease association. (HuGE Navigator)
19220833 Observational study of gene-disease association. (HuGE Navigator)
19109177 H-ficolin residue lysine47 is a key component of the interaction with both mannan-binding lectin (MBL)-associated serine proteases and calreticulin, providing a strong indication that MBL and ficolins share homologous binding sites for their partners.
18950864 l-ficolin participates in host defence during the perinatal period and constitute the first evidence that relative l-ficolin deficiency may contribute to the adverse consequences of prematurity. Some similar trends were found with facets of MBL deficiency
18486240 Few glycans bound L-ficolin above background level but clear structural requirements were discovered
18032536 Observational study of gene-disease association. (HuGE Navigator)
17680820 Observational study of gene-disease association. (HuGE Navigator)
17680820 in children with recurrent infections,low l-ficolin levels were associated with variant alleles for ss32469536 & rs7851696 & normal alleles for ss32469537 & ss32469544; high l-ficolin levels were associated with variant alleles of ss32469537 & ss32469544
17386030 inter-individual variation of Ficolin-2 concentration is associated with polymorphisms in the promoter and the structural part of the FCN2 gene
17382393 Observational study of gene-disease association. (HuGE Navigator)
17382393 Although the five FCN2 polymorphisms were each present in the UK Caucasian population studied, no significant associations were observed between the FCN2 polymorphisms and susceptibility to pneumococcal disease.
17215869 The X-ray structures of l-ficolin trimeric recognition domains, alone and in complex with various ligands, have been solved.
16839748 Observational study of gene-disease association. (HuGE Navigator)
16839748 The significant differences in allele frequencies of FCN2 gene SNPs in the promoter lesions among HLA-B51 positive BD patients may reveal the possibility that ficolin may contribute to the innate immunity of BD among HLA-B51 haplotypes in BD patients.
16820685 Ficolins, a kind of pattern-recognition molecule for pathogens in the innate immunity system were examined crystallographically.
16076493 Two conserved coding SNPs were found in exon 8, leading to amino acid substitutions within the fibrinogen-like domain.
15331601 examined the selectivity of L-ficolin through inhibiting the binding to bacteria or to beads coupled with N-acetylglucosamine
14707097 L-ficolin-lipoteichoic acid interaction initiates an innate anti-microbial immune response by triggering the lectin pathway of complement activation.
12421953 The interaction of L-ficolin/p35 with the full-length mannan-binding lectin (MBL)-associated serine proteases (MASP-1 and -2), N-terminal complement modules and MBL-associated protein 19 has been characterized using surface plasmon resonance spectroscopy.

AA Sequence

MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGK      1 - 70
RGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGG     71 - 140
GWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSF    141 - 210
KVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYL    211 - 280
RGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA                                         281 - 313
//

Text Mined References (85)

PMID Year Title
26464189 2016 Ficolin Gene Polymorphisms in Systemic Lupus Erythematosus and Rheumatoid Arthritis.
26379154 2015 Association of the FCN2 Gene Single Nucleotide Polymorphisms with Susceptibility to Pulmonary Tuberculosis.
26207622 2015 Association Study of Mannose-Binding Lectin Levels and Genetic Variants in Lectin Pathway Proteins with Susceptibility to Age-Related Macular Degeneration: A Case-Control Study.
26074063 2015 Studies of the binding of ficolin-2 and ficolin-3 from the complement lectin pathway to Leptospira biflexa, Pasteurella pneumotropica and Diarrheagenic Escherichia coli.
25965808 2015 Association of Ficolin-2 Serum Levels and FCN2 Genetic Variants with Indian Visceral Leishmaniasis.
25612732 2015 The serum opsonin L-ficolin is detected in lungs of human transplant recipients following fungal infections and modulates inflammation and killing of Aspergillus fumigatus.
25447524 2014 Human ficolin-2 recognition versatility extended: an update on the binding of ficolin-2 to sulfated/phosphated carbohydrates.
25344472 2014 Human L-ficolin recognizes phosphocholine moieties of pneumococcal teichoic acid.
25251245 2015 Low ficolin-2 levels in common variable immunodeficiency patients with bronchiectasis.
25174443 2015 Heparin-coated cardiopulmonary bypass circuits selectively deplete the pattern recognition molecule ficolin-2 of the lectin complement pathway in vivo.
25083730 2014 Lack of association of serum mannose/mannan binding lectin or ficolins with complement activation in patients with antiphospholipid antibodies.
25069872 2015 Ficolins and the lectin pathway of complement in patients with systemic lupus erythematosus.
25024112 2014 Mannose-binding lectin and ficolin-2 do not influence humoral immune response to hepatitis B vaccine.
24928988 2014 Ficolin-2 inhibits hepatitis C virus infection, whereas apolipoprotein E3 mediates viral immune escape.
24854201 2014 Recombinant human L-ficolin directly neutralizes hepatitis C virus entry.
24736883 2014 Serum ficolin-2 in hospitalised patients with community-acquired pneumonia.
24683196 2014 Low invasiveness of pneumococcal serotype 11A is linked to ficolin-2 recognition of O-acetylated capsule epitopes and lectin complement pathway activation.
24486561 2014 Mannose-binding lectin-2 and ficolin-2 gene polymorphisms and clinical risk factors for acute rejection in kidney transplantation.
24453114 2014 Mannose binding lectin and ficolin-2 polymorphisms are associated with increased risk for bacterial infections in children with B acute lymphoblastic leukemia.
24227370 2013 Risk of infection and sepsis in severely injured patients related to single nucleotide polymorphisms in the lectin pathway.
24182802 2013 Mannose-binding lectin 2 and ficolin-2 gene polymorphisms influence the susceptibility to bloodstream infections in kidney transplant recipients.
24040095 2013 Ficolin-2 defends against virulent Mycobacteria tuberculosis infection in vivo, and its insufficiency is associated with infection in humans.
23911396 2013 Ficolin-2 reveals different analytical and biological properties dependent on different sample handling procedures.
23744477 2013 Ficolin-2 and ficolin-3 in women with malignant and benign ovarian tumours.
23619474 2013 The relationship between FCN2 genotypes and serum ficolin-2 (L-ficolin) protein concentrations from a large cohort of neonates.
23593180 2013 Association of L-ficolin levels and FCN2 genotypes with chronic Chagas disease.
23525825 2013 Cost-effective procedures for genotyping of human FCN2 gene single nucleotide polymorphisms.
23423485 2013 Genetic variants of complement genes ficolin-2, mannose-binding lectin and complement factor H are associated with leprosy in Han Chinese from Southwest China.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23298162 2013 Early increased ficolin-2 concentrations are associated with severity of liver inflammation and efficacy of anti-viral therapy in chronic hepatitis C patients.
22892990 2012 The functional polymorphism Ala258Ser in the innate receptor gene ficolin-2 in the donor predicts improved renal transplant outcome.
22693230 2012 Ficolin-2 levels and FCN2 genetic polymorphisms as a susceptibility factor in schistosomiasis.
22670778 2012 Circulating ficolin-2 and ficolin-3 in normal pregnancy and pre-eclampsia.
22594803 2012 Reliable and rapid characterization of functional FCN2 gene variants reveals diverse geographical patterns.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22457818 2012 Genetic evidence of functional ficolin-2 haplotype as susceptibility factor in cutaneous leishmaniasis.
22350641 2012 Serum L-ficolin levels in patients with systemic lupus erythematosus.
22173059 2012 Lectin complement pathway gene profile of the donor and recipient does not influence graft outcome after kidney transplantation.
22140517 2011 Ficolin-2 levels and FCN2 haplotypes influence hepatitis B infection outcome in Vietnamese patients.
22082351 2012 The potential role of the lectin pathway of complement in the host defence of full-term intrauterine growth restricted neonates at birth.
21490156 2011 M-ficolin interacts with the long pentraxin PTX3: a novel case of cross-talk between soluble pattern-recognition molecules.
21334396 2011 Mannose-binding lectin and ficolin-2 gene polymorphisms predispose to cytomegalovirus (re)infection after orthotopic liver transplantation.
21327568 2011 Mannan-binding lectin and ficolin deposition in skin lesions of pemphigus.
21054788 2010 CD91 interacts with mannan-binding lectin (MBL) through the MBL-associated serine protease-binding site.
20937340 2011 Ficolin-2 levels and genetic polymorphisms of FCN2 in malaria.
20682603 2011 Mannose-binding lectin (MBL2) and ficolin-2 (FCN2) polymorphisms in patients on peritoneal dialysis with staphylococcal peritonitis.
20593422 2010 Lectin complement pathway gene profile of donor and recipient determine the risk of bacterial infections after orthotopic liver transplantation.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19767106 2009 L-ficolin (ficolin-2) insufficiency is associated with combined allergic and infectious respiratory disease in children.
19728924 2009 Specifically binding of L-ficolin to N-glycans of HCV envelope glycoproteins E1 and E2 leads to complement activation.
19664148 2009 Ficolin 2 (FCN2) functional polymorphisms and the risk of rheumatic fever and rheumatic heart disease.
19632990 2009 Synergy between ficolin-2 and pentraxin 3 boosts innate immune recognition and complement deposition.
19434912 2009 Functional haplotypes that produce normal ficolin-2 levels protect against clinical leprosy.
19220833 2009 Exploring the role of polymorphisms in ficolin genes in respiratory tract infections in children.
19109177 2009 Residue Lys57 in the collagen-like region of human L-ficolin and its counterpart Lys47 in H-ficolin play a key role in the interaction with the mannan-binding lectin-associated serine proteases and the collectin receptor calreticulin.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18950864 2009 Two factors of the lectin pathway of complement, l-ficolin and mannan-binding lectin, and their associations with prematurity, low birthweight and infections in a large cohort of Polish neonates.
18486240 2008 Recognition of acetylated oligosaccharides by human L-ficolin.
18032536 2007 Polymorphisms in the ficolin 1 gene (FCN1) are associated with susceptibility to the development of rheumatoid arthritis.
17680820 2007 Extremes of L-ficolin concentration in children with recurrent infections are associated with single nucleotide polymorphisms in the FCN2 gene.
17386030 2007 The impact of FCN2 polymorphisms and haplotypes on the Ficolin-2 serum levels.
17382393 2007 Functional polymorphisms in the FCN2 gene are not associated with invasive pneumococcal disease.
17215869 2007 Structural insights into the innate immune recognition specificities of L- and H-ficolins.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16839748 2006 Single nucleotide polymorphisms of Ficolin 2 gene in Behçet's disease.
16820685 2006 Overexpression, purification and preliminary crystallographic analysis of human M-ficolin fibrinogen-like domain.
16076493 2006 Coding and non-coding polymorphisms in the lectin pathway activator L-ficolin gene in 188 Dutch blood bank donors.
15804047 2005 Specific binding of L-ficolin and H-ficolin to apoptotic cells leads to complement activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15331601 2004 L-ficolin is a pattern recognition molecule specific for acetyl groups.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14707097 2004 L-ficolin specifically binds to lipoteichoic acid, a cell wall constituent of Gram-positive bacteria, and activates the lectin pathway of complement.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14660572 2004 The disulfide bonding pattern in ficolin multimers.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421953 2002 Characterization of the interaction between L-ficolin/p35 and mannan-binding lectin-associated serine proteases-1 and -2.
11446374 2000 Opsonic function and concentration of human serum ficolin/P35.
10679061 2000 Cutting edge: complement-activating complex of ficolin and mannose-binding lectin-associated serine protease.
10232391 1999 P35, an opsonic lectin of the ficolin family, in human blood from neonates, normal adults, and recurrent miscarriage patients.
9777405 1998 Ficolins and the fibrinogen-like domain.
9202708 1997 Purification and binding properties of a human ficolin-like protein.
8884275 1996 Cloning and characterization of the human lectin P35 gene and its related gene.
8586615 1995 EBP-37, a new elastin-binding protein in human plasma: structural similarity to ficolins, transforming growth factor-beta 1-binding proteins.
8576206 1996 A novel human serum lectin with collagen- and fibrinogen-like domains that functions as an opsonin.
7498469 1995 Hucolin, a new corticosteroid-binding protein from human plasma with structural similarities to ficolins, transforming growth factor-beta 1-binding proteins.