Property Summary

NCBI Gene PubMed Count 23
PubMed Score 50.68
PubTator Score 50.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.223 2.1e-02
chronic lymphocytic leukemia 1.134 4.9e-03
cutaneous lupus erythematosus 2.800 6.7e-03
osteosarcoma -3.020 5.6e-05
posterior fossa group A ependymoma 1.200 5.5e-06
atypical teratoid / rhabdoid tumor 1.300 8.6e-04
glioblastoma 1.700 2.5e-06
medulloblastoma 1.200 1.6e-04
medulloblastoma, large-cell 1.700 3.3e-05
lung cancer -1.200 1.9e-03
interstitial cystitis 2.400 5.7e-03
adult high grade glioma 1.400 2.8e-03
primary Sjogren syndrome 2.100 5.5e-04
nasopharyngeal carcinoma -1.500 4.7e-03
ductal carcinoma in situ 2.000 6.8e-03
invasive ductal carcinoma 1.900 2.3e-02
ulcerative colitis 1.500 1.6e-02
ovarian cancer -1.500 6.3e-13
psoriasis 1.900 3.2e-89

Gene RIF (15)

PMID Text
22675200 Toso/FcmuR is an IgM receptor capable of activating signaling molecules and whose expression alone is not inherently antiapoptotic.
21908732 TOSO/FAIM3 may play a role in immune surveillance and contribute to B cell activation
21908424 Enhanced levels of both membrane-bound and soluble forms of FcmuR in CLL patients.
21756805 Overexpression of TOSO in chronic lymphocytic leukemia is associated with disease progression.
21613257 we demonstrate that the immune specific cell surface molecule Toso exhibits antiapoptotic effects on death receptor signaling by a novel regulatory mechanism involving the adaptor kinase RIP1
21264533 Overexpression of TOSO gene is associated with chronic lymphocytic leukemia.
21133733 TOSO is overexpressed and correlated with disease progression in chronic lymphocytic leukemia.
20410497 This review focuses on possible functional consequences of Plasmodium falciparum EMP1 protein interaction with the IgM receptor, including interference with immunologic signaling and clearance mechanisms and blocking of specific antibody binding.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20042454 These results identify TOSO/FAIM3 as a receptor for IgM
19858324 Although this receptor was initially designated as Fas apoptotic inhibitory molecule 3, or TOSO, our results indicate that FcmuR per se has no inhibitory activity in Fas-mediated apoptosis
19347734 TOSO as a mediator of resistance to apoptosis in chronic lymphocytic leukemia [review]
18708628 association with unmutated IgV(H) and the specific induction of TOSO via the BCR suggest autoreactive BCR signaling as a key mediator of apoptosis resistance in CLL.
18434611 demonstrated a 5.6-fold increase of TOSO protein in circulating CLL cells and lymph nodes
17553462 enzymatically modified-LDL-generated foam cells are protected from cell death most likely through the expression of TOSO by a FLIP(L) independent mechanism

AA Sequence

MDFWLWPLYFLPVSGALRILPEVKVEGELGGSVTIKCPLPEMHVRIYLCREMAGSGTCGTVVSTTNFIKA      1 - 70
EYKGRVTLKQYPRKNLFLVEVTQLTESDSGVYACGAGMNTDRGKTQKVTLNVHSEYEPSWEEQPMPETPK     71 - 140
WFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTA    141 - 210
SKISALEGLLKPQTPSYNHHTRLHRQRALDYGSQSGREGQGFHILIPTILGLFLLALLGLVVKRAVERRK    211 - 280
ALSRRARRLAVRMRALESSQRPRGSPRPRSQNNIYSACPRRARGADAAGTGEAPVPGPGAPLPPAPLQVS    281 - 350
ESPWLHAPSLKTSCEYVSLYHQPAAMMEDSDSDDYINVPA                                  351 - 390
//

Text Mined References (26)

PMID Year Title
25888699 2015 Nomenclature of Toso, Fas apoptosis inhibitory molecule 3, and IgM FcR.
22675200 2012 Toso, a functional IgM receptor, is regulated by IL-2 in T and NK cells.
21908732 2011 TOSO, the Fcmicro receptor, is highly expressed on chronic lymphocytic leukemia B cells, internalizes upon IgM binding, shuttles to the lysosome, and is downregulated in response to TLR activation.
21908424 2011 Enhanced levels of both the membrane-bound and soluble forms of IgM Fc receptor (Fc?R) in patients with chronic lymphocytic leukemia.
21756805 2011 [Expression and prognostic significance of TOSO in CD19+ B cells from Chinese CLL patients].
21613257 2011 Toso regulates the balance between apoptotic and nonapoptotic death receptor signaling by facilitating RIP1 ubiquitination.
21264533 2012 Overexpression of Fc mu receptor (FCMR, TOSO) gene in chronic lymphocytic leukemia patients.
21133733 2011 TOSO is overexpressed and correlated with disease progression in Chinese patients with chronic lymphocytic leukemia.
20410497 2010 IgM, Fc mu Rs, and malarial immune evasion.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20042454 2010 Identification of TOSO/FAIM3 as an Fc receptor for IgM.
19858324 2009 Identity of the elusive IgM Fc receptor (FcmuR) in humans.
19347734 2009 Overexpression of the Fas-inhibitory molecule TOSO: a novel antiapoptotic factor in chronic lymphocytic leukemia.
18708628 2008 Overexpression of TOSO in CLL is triggered by B-cell receptor signaling and associated with progressive disease.
18434611 2008 SAGE analysis demonstrates increased expression of TOSO contributing to Fas-mediated resistance in CLL.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17553462 2007 E-LDL upregulates TOSO expression and enhances the survival of human macrophages.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9586636 1998 Toso, a cell surface, specific regulator of Fas-induced apoptosis in T cells.
1563211 1992 Effects of misoprostol on the pharmacokinetics of indomethacin in human volunteers.