Property Summary

NCBI Gene PubMed Count 16
PubMed Score 34.26
PubTator Score 4.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.400 5.7e-04
osteosarcoma -3.238 4.9e-10
tuberculosis and treatment for 3 months 1.500 4.3e-07
interstitial cystitis 1.100 1.3e-03
primary Sjogren syndrome 1.200 1.2e-02
ulcerative colitis 1.500 4.3e-05
ovarian cancer 1.500 1.5e-03
pituitary cancer 1.100 4.2e-06
Down syndrome 1.200 3.1e-04

Gene RIF (2)

PMID Text
22902056 our study, for the first time, demonstrates FCHSD2 as a predictor of outcome for Acute myeloid leukemia patients
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MQPPPRKVKVTQELKNIQVEQMTKLQAKHQAECDLLEDMRTFSQKKAAIEREYAQGMQKLASQYLKRDWP      1 - 70
GVKADDRNDYRSMYPVWKSFLEGTMQVAQSRMNICENYKNFISEPARTVRSLKEQQLKRCVDQLTKIQTE     71 - 140
LQETVKDLAKGKKKYFETEQMAHAVREKADIEAKSKLSLFQSRISLQKASVKLKARRSECNSKATHARND    141 - 210
YLLTLAAANAHQDRYYQTDLVNIMKALDGNVYDHLKDYLIAFSRTELETCQAVQNTFQFLLENSSKVVRD    211 - 280
YNLQLFLQENAVFHKPQPFQFQPCDSDTSRQLESETGTTEEHSLNKEARKWATRVAREHKNIVHQQRVLN    281 - 350
DLECHGAAVSEQSRAELEQKIDEARENIRKAEIIKLKAEARLDLLKQIGVSVDTWLKSAMNQVMEELENE    351 - 420
RWARPPAVTSNGTLHSLNADTEREEGEEFEDNMDVFDDSSSSPSGTLRNYPLTCKVVYSYKASQPDELTI    421 - 490
EEHEVLEVIEDGDMEDWVKARNKVGQVGYVPEKYLQFPTSNSLLSMLQSLAALDSRSHTSSNSTEAELVS    491 - 560
GSLNGDASVCFVKALYDYEGQTDDELSFPEGAIIRILNKENQDDDGFWEGEFNGRIGVFPSVLVEELSAS    561 - 630
ENGDTPWMREIQISPSPKPHASLPPLPLYDQPPSSPYPSPDKRSSLYFPRSPSANEKSLHAESPGFSQAS    631 - 700
RHTPETSYGKLRPVRAAPPPPTQNHRRPAEKIEDVEITLV                                  701 - 740
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
23850713 2014 Genome-wide association study of Crohn's disease in Koreans revealed three new susceptibility loci and common attributes of genetic susceptibility across ethnic populations.
23266558 2013 A genome-wide association study identifies 2 susceptibility Loci for Crohn's disease in a Japanese population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22902056 2012 FCHSD2 predicts response to chemotherapy in acute myeloid leukemia patients.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18654987 2008 Identification of multi-SH3 domain-containing protein interactome in pancreatic cancer: a yeast two-hybrid approach.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15067381 2004 Identification and characterization of human FCHSD1 and FCHSD2 genes in silico.
14980202 2004 Nervous wreck, an SH3 adaptor protein that interacts with Wsp, regulates synaptic growth in Drosophila.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14627983 2003 Carom: a novel membrane-associated guanylate kinase-interacting protein with two SH3 domains.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
9873 1975 [Pulmonary edema in hangings].