Property Summary

NCBI Gene PubMed Count 18
PubMed Score 35.29
PubTator Score 4.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Down syndrome 1.200 3.1e-04
interstitial cystitis 1.100 1.3e-03
osteosarcoma -3.238 4.9e-10
ovarian cancer 1.500 1.5e-03
pituitary cancer 1.100 4.2e-06
primary Sjogren syndrome 1.200 1.2e-02
psoriasis -1.400 5.7e-04
tuberculosis 1.100 4.0e-07
ulcerative colitis 1.500 4.3e-05

Gene RIF (4)

AA Sequence

MQPPPRKVKVTQELKNIQVEQMTKLQAKHQAECDLLEDMRTFSQKKAAIEREYAQGMQKLASQYLKRDWP      1 - 70
GVKADDRNDYRSMYPVWKSFLEGTMQVAQSRMNICENYKNFISEPARTVRSLKEQQLKRCVDQLTKIQTE     71 - 140
LQETVKDLAKGKKKYFETEQMAHAVREKADIEAKSKLSLFQSRISLQKASVKLKARRSECNSKATHARND    141 - 210
YLLTLAAANAHQDRYYQTDLVNIMKALDGNVYDHLKDYLIAFSRTELETCQAVQNTFQFLLENSSKVVRD    211 - 280
YNLQLFLQENAVFHKPQPFQFQPCDSDTSRQLESETGTTEEHSLNKEARKWATRVAREHKNIVHQQRVLN    281 - 350
DLECHGAAVSEQSRAELEQKIDEARENIRKAEIIKLKAEARLDLLKQIGVSVDTWLKSAMNQVMEELENE    351 - 420
RWARPPAVTSNGTLHSLNADTEREEGEEFEDNMDVFDDSSSSPSGTLRNYPLTCKVVYSYKASQPDELTI    421 - 490
EEHEVLEVIEDGDMEDWVKARNKVGQVGYVPEKYLQFPTSNSLLSMLQSLAALDSRSHTSSNSTEAELVS    491 - 560
GSLNGDASVCFVKALYDYEGQTDDELSFPEGAIIRILNKENQDDDGFWEGEFNGRIGVFPSVLVEELSAS    561 - 630
ENGDTPWMREIQISPSPKPHASLPPLPLYDQPPSSPYPSPDKRSSLYFPRSPSANEKSLHAESPGFSQAS    631 - 700
RHTPETSYGKLRPVRAAPPPPTQNHRRPAEKIEDVEITLV                                  701 - 740
//

Text Mined References (22)

PMID Year Title