Property Summary

NCBI Gene PubMed Count 92
PubMed Score 598.76
PubTator Score 1135.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
esophageal adenocarcinoma 1.100 2.4e-02
glioblastoma 2.000 1.3e-03
posterior fossa group A ependymoma 1.300 1.8e-08
astrocytoma 1.800 1.1e-03
atypical teratoid / rhabdoid tumor 1.100 7.1e-05
adrenocortical carcinoma -1.623 1.1e-04
tuberculosis and treatment for 3 months 1.400 1.3e-06
non-small cell lung cancer -1.245 9.5e-21
active Crohn's disease -1.389 2.2e-02
adult high grade glioma 1.500 1.7e-03
pilocytic astrocytoma 1.800 6.2e-10
subependymal giant cell astrocytoma 1.677 4.3e-02
lung carcinoma -1.400 7.5e-27
ductal carcinoma in situ -1.100 4.5e-03
ulcerative colitis -1.800 1.2e-10

 CSPA Cell Line (3)

Pathway (1)

Gene RIF (77)

PMID Text
26337808 Data indicate improved pharmacokinetics through enhanced neonatal Fc receptor (FcRn) interactions were apparent for a complementarity-determining region (CDR) charge-patch normalized monoclonal antibody (mAb) which was affected by non-specific clearance.
26260795 Critical Role of the Neonatal Fc Receptor (FcRn) in the Pathogenic Action of Antimitochondrial Autoantibodies Synergizing with Anti-desmoglein Autoantibodies in Pemphigus Vulgaris.
26254986 FcRn binding activity of a large set of Fc-fusion samples after thermal stress, was investigated.
26252948 analysis of binding motifs in the hFCGRT promoter that interact with their corresponding (Sp1, Sp2, Sp3, c-Fos, c-Jun, YY1, and C/EBPbeta or C/EBPdelta) transcription factors (TFs) suggests their involvement in regulation of human FCGRT gene expression
25823782 none of the three functional polymorphisms in FcgammaR genes explored here, the FCGR3A F158V and FCGR2B I232T nsSNPs and the VNTR in FCGRT, showed an association with the response to TNFi in patients with rheumatoid arthritis
25658443 The neonatal Fc receptor (FcRn) binds independently to both sites of the IgG homodimer with identical affinity.
25652137 These data indicate that human FcRn facilitates the transepithelial transport of IgE in the form of IgG anti-IgE/IgE ICs.
25344603 domain I and III of albumin required for optimal pH-dependent binding to the neonatal Fc receptor
25030041 These results suggest that hFcRn Tgm are a valuable and useful tool for pharmacokinetic screening of mAbs and Fc-fusion proteins in the preclinical stage.
24853685 The extents of IgG expression in 86 lung cancers were found to associate with clinical stage, pathological grade and lymph node metastasis.
24802048 Characterization and screening of IgG binding to the neonatal Fc receptor.
24764301 A cluster of conserved tryptophan residues of FcRn is required for binding to albumin and anti-FcRn albumin blocking antibodies.
24652290 Extending serum half-life of albumin by engineering neonatal Fc receptor (FcRn) binding.
24550358 FcRn has the potential to interact with IgG-Fc domains in the ciliary epithelium and retinal and choroidal vasculature, which might affect the half-life and distribution of intravitreally injected Fc-carrying molecules.
24469444 analysis of neonatal Fc receptor-based recycling mechanisms through identification of the human Fc interaction with human FcRn
24278022 The Neonatal Fc receptor (FcRn) enhances human immunodeficiency virus type 1 (HIV-1) transcytosis across epithelial cells.
24072267 In intestine, there was an increasing proximal-distal gradient of mucosal FcRn mRNA and protein expression.
24057047 Molecular dynamic simulations of human FcRn-Fc binding structures proposed that the protein-protein binding interface is composed of three subsites.
23917469 Studies indicate that high levels of endogenous IgG can compete with the monoclonal antibodies (mAbs) for binding to the neonatal Fc receptor (FcRn).
23765230 Analytical FcRn chromatography allows differentiation of IgG samples and variants by peak pattern and retention time profile.
23751752 The FCGRT promoter VNTR may influence mAbs' distribution in the body. CNV of FCGRT cannot be used as a relevant pharmacogenetic marker because of its low frequency.
23741050 Only the unbound receptor or FcRn bound to monomeric IgG is sorted into recycling tubules emerging from early endosomes.
23384837 Data indicate that Fc-neonatal Fc receptor (FcRn) interaction is pH dependent.
23286945 genetic polymorphism is associated with the efficiency of Ig replacement therapy in common variable immunodeficiency
23220220 Human FcRn was visualized in epithelial cells of Tg276 mice, but low serum hIgG levels were obtained
22570488 Serum half-life of IgG is controlled by the neonatal Fc receptor (FcRn) that interacts with the IgG Fc region and may be increased or decreased as a function of altered FcRn binding.
22453095 This mAb panel provides a powerful resource for probing the biology of human FcRn and for the evaluation of therapeutic FcRn blockade strategies.
22215085 Structure-based mutagenesis reveals the albumin-binding site of the neonatal Fc receptor
21690327 FcRn transgene blockade is a primary contributing factor toward reduction in arthritis severity; engineering of antibody Fc regions to generate potent FcRn blockers holds promise for the therapy of antibody-mediated autoimmunity in experimental arthritis.
21368166 These studies demonstrate that FcRn-mediated transport is a mechanism by which IgG can act locally in the female genital tract in immune surveillance and in host defense against sexually transmitted diseases.
21256596 Methionine (Met) oxidation can result in a significant reduction of the serum circulation half-life and the magnitude of the change correlates well with the extent of Met oxidation and changes in FcRn binding affinities.
20930418 Thirty-three genetic variations of FCGRT, including 17 novel ones, were found.
20627700 influence of FcRn expression on disease phenotype and the catabolism of therapeutically administered intravenous immunoglobulins in 28 patients with common variable immunodeficiency
20592032 the x-ray crystal structure of a representative monomeric peptide in complex with human FcRn
20452034 promoter polymorphism is not associted with the rate of maternal-fetal IgG transfer
20452034 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20083659 Affinities to FcRn of clinically used therapeutic proteins are closely correlated with the serum half-lives reported from clinical studies, and suggest an important role of FcRn in regulating the serum half-lives of the therapeutic proteins.
20018855 No binding of albumin was observed at physiological pH to neonatal Fc receptor. At acidic pH, a 100-fold difference in binding affinity was observed.
20006594 A recombinant truncated HSA variant, HSA(Bartin), does not interact with FcRn, which gives a molecular explanation for the low serum levels.
19772792 Observational study of gene-disease association. (HuGE Navigator)
19772792 VNTR polymorphisms within the FCGRT promoter are not associated with LN in the Chinese population.
19462839 It plays a role in intracellular IGG transfer and immune surveillance. (review)
19451275 a single structurally and functionally heterogeneous recycling endosome compartment that traffics FcRn to both cell surfaces while discriminating between recycling and transcytosis pathways polarized in their direction of transport
19423540 Observational study of gene-disease association. (HuGE Navigator)
19362735 The role of hFcRn in IgG transport and trafficking in syncytiotrophoblasts cultures in vitro.
19164298 N-glycans in FcRn contribute significantly to the steady-state membrane distribution and direction of IgG transport in polarized epithelia.
18843053 Results indicate that FcRn-dependent internalization of IgG may be important not only in cells taking up IgG from an extracellular acidic space, but also in endothelial cells participating in homeostatic regulation of circulating IgG levels.
18684948 Intracellular trafficking of FcRn is regulated by its intrinsic sorting information and/or an interaction with major histocompatibility (MHC) class II invariant chain (Ii).
18637944 The impact of two free cysteine residues (C48 and C251) of the FcRn heavy chain on the overall structure and function of soluble human FcRn is explored.
18599440 A previously undescribed role for FcRn in mediating the presentation of antigens by dendritic cells when antigens are present as a complex with antibody, is shown.
18566411 JAK/STAT-1 signaling pathway was necessary and sufficient to mediate the down-regulation of FcRn gene expression by IFN-gamma
18003977 These results suggest a novel mechanism for regulation of IgG transport by calmodulin-dependent sorting of FcRn and its cargo away from a degradative pathway and into a bidirectional transcytotic route.
17709515 These data provide the first evidence that NF-kappaB signaling via intronic sequences regulates FcRn expression and function.
17703228 This review summarizes FcRn biology.
17674040 Neonatal Fc receptor (FcRn) was expressed in various cells of the human skin (including keratinocytes, melanocytes, and histiocytes).
17384151 Elucidation of intracellular recycling pathways leading to exocytosis of FCRN was facilitated by using multifocal plane micoscopy.
17048273 Our results show clear evidence that the conserved H166 is a key player in the FcRn-albumin interaction.
17046328 FcRn-mediated recycling is a major contributor to the high endogenous concentrations of IgG and serum albumin, two important plasma proteins.
16849638 FcRn fulfills a major role in IgG-mediated phagocytosis
16805790 a variable number of tandem repeats promoter polymorphism influences the expression of the FcRn receptor, leading to different IgG-binding capacities
16549777 FcRn binds IgG and albumin, salvages both from a degradative fate, and maintains their physiologic concentrations
16229888 These transport and localization data are in accordance with efficient hFcRn-mediated apical IgG recycling and basolateral directed IgG transcytosis in placental trophoblasts.
15689494 FcRn leaves sorting endosomes in Rab4(+)Rab11(+) or Rab11(+) compartments
15654966 expression of a functional FcRn in normal human epidermal keratinocytes.
15644205 residues encompassing and extending away from the interaction site on the alpha2 helix of FcRn play a significant and most likely indirect role in FcRn-IgG interactions
15258288 FCRN is involved in IgG exocytosis.
14767057 strong cell surface polarity displayed by hFcRn results from dominant basolateral sorting by motifs in the cytoplasmic tail that nonetheless allows for a cycle of bidirectional transcytosis
14764666 Analysis of the dynamics and properties of trafficking of FcRn in live microvascular endothelial cells shows that the primary site at which FcRn sorts IgGs for either salvage or lysosomal degradation is the sorting endosome.
12972260 data show that it is possible to confer binding of mouse immunoglobulin G on human FcRn by mutagenesis of selected residues; observations are of direct relevance to understanding the molecular nature of the human FcRn-IgG interaction
12538789 Expression of FcRn is demonstrated along the human fetal intestine and in a human nonmalignant fetal intestinal epithelial cell line (H4), which by location indicates that FcRn could play a role in the uptake and transport of IgG in the human fetus.
12144784 although a secreted soluble form of human FcRn does not dimerize, the membrane-anchored receptor can form both non-covalent and covalent dimers; dimerization of human FcRn occurs in the absence of its ligand, IgG
12023961 Functional reconstitution in Madin-Darby canine kidney cells requires co-expressed human beta 2-microglobulin
12006623 Assembly of the FcRn alpha-chain with beta(2)microglobulin is important for both transport of FcRn from the ER to the cell surface and efficient pH-dependent IgG binding.
11717196 Human FcRn binds selectively to human, rabbit and guinea pig IgG but not significantly to rat, bovine, sheep or mouse IgG (except for weak binding to mouse IgG2b).
8145026 Preincubation of monocytes with HIV-1 gp120 depresses anti-CD3 antibody-induced T cell stimulation and Fc receptor-mediated phagocytosis

AA Sequence

MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEP      1 - 70
CGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEF     71 - 140
MNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKAR    141 - 210
PSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHA    211 - 280
GLAQPLRVELESPAKSSVLVVGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEA    281 - 350
QDADLKDVNVIPATA                                                           351 - 365
//

Text Mined References (96)

PMID Year Title
26337808 2015 The interplay of non-specific binding, target-mediated clearance and FcRn interactions on the pharmacokinetics of humanized antibodies.
26260795 2015 Critical Role of the Neonatal Fc Receptor (FcRn) in the Pathogenic Action of Antimitochondrial Autoantibodies Synergizing with Anti-desmoglein Autoantibodies in Pemphigus Vulgaris.
26254986 2015 Effect of protein aggregates on characterization of FcRn binding of Fc-fusion therapeutics.
26252948 2015 Analysis of Response Elements Involved in the Regulation of the Human Neonatal Fc Receptor Gene (FCGRT).
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25823782 2015 FCGR polymorphisms in the treatment of rheumatoid arthritis with Fc-containing TNF inhibitors.
25658443 2015 The neonatal Fc receptor (FcRn) binds independently to both sites of the IgG homodimer with identical affinity.
25652137 2015 Evidence that FcRn mediates the transplacental passage of maternal IgE in the form of IgG anti-IgE/IgE immune complexes.
25344603 2014 Interaction with both domain I and III of albumin is required for optimal pH-dependent binding to the neonatal Fc receptor (FcRn).
25030041 2014 Application of human FcRn transgenic mice as a pharmacokinetic screening tool of monoclonal antibody.
24853685 2014 Immunoglobulin G expression in lung cancer and its effects on metastasis.
24802048 Characterization and screening of IgG binding to the neonatal Fc receptor.
24764301 2014 Dissection of the neonatal Fc receptor (FcRn)-albumin interface using mutagenesis and anti-FcRn albumin-blocking antibodies.
24652290 2014 Extending serum half-life of albumin by engineering neonatal Fc receptor (FcRn) binding.
24550358 2014 Expression of neonatal Fc receptor in the eye.
24469444 2014 Structural insights into neonatal Fc receptor-based recycling mechanisms.
24278022 2013 The Neonatal Fc receptor (FcRn) enhances human immunodeficiency virus type 1 (HIV-1) transcytosis across epithelial cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24072267 2014 Human and non-human primate intestinal FcRn expression and immunoglobulin G transcytosis.
24057047 2013 Binding structures and energies of the human neonatal Fc receptor with human Fc and its mutants by molecular modeling and dynamics simulations.
23917469 2013 Are endosomal trafficking parameters better targets for improving mAb pharmacokinetics than FcRn binding affinity?
23765230 Analytical FcRn affinity chromatography for functional characterization of monoclonal antibodies.
23751752 Influence of FCGRT gene polymorphisms on pharmacokinetics of therapeutic antibodies.
23741050 2013 Multivalent immune complexes divert FcRn to lysosomes by exclusion from recycling sorting tubules.
23384837 2013 Qualification of a homogeneous cell-based neonatal Fc receptor (FcRn) binding assay and its application to studies on Fc functionality of IgG-based therapeutics.
23286945 2013 Efficiency of immunoglobulin G replacement therapy in common variable immunodeficiency: correlations with clinical phenotype and polymorphism of the neonatal Fc receptor.
23220220 2013 Contribution of FcRn binding to intestinal uptake of IgG in suckling rat pups and human FcRn-transgenic mice.
23022100 2012 Discovery and fine mapping of serum protein loci through transethnic meta-analysis.
22570488 2012 Anti-carcinoembryonic antigen single-chain variable fragment antibody variants bind mouse and human neonatal Fc receptor with different affinities that reveal distinct cross-species differences in serum half-life.
22453095 Monoclonal antibodies directed against human FcRn and their applications.
22215085 2012 Structure-based mutagenesis reveals the albumin-binding site of the neonatal Fc receptor.
21690327 2011 Neonatal Fc receptor blockade by Fc engineering ameliorates arthritis in a murine model.
21368166 2011 Transfer of IgG in the female genital tract by MHC class I-related neonatal Fc receptor (FcRn) confers protective immunity to vaginal infection.
21269460 2011 Initial characterization of the human central proteome.
21256596 2011 Impact of methionine oxidation in human IgG1 Fc on serum half-life of monoclonal antibodies.
20930418 2010 Genetic polymorphisms of FCGRT encoding FcRn in a Japanese population and their functional analysis.
20627700 2010 Association of FcRn expression with lung abnormalities and IVIG catabolism in patients with common variable immunodeficiency.
20592032 2010 X-ray crystal structures of monomeric and dimeric peptide inhibitors in complex with the human neonatal Fc receptor, FcRn.
20452034 2010 No association of FCRN promoter VNTR polymorphism with the rate of maternal-fetal IgG transfer.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20083659 2010 Importance of neonatal FcR in regulating the serum half-life of therapeutic proteins containing the Fc domain of human IgG1: a comparative study of the affinity of monoclonal antibodies and Fc-fusion proteins to human neonatal FcR.
20018855 2010 Cross-species binding analyses of mouse and human neonatal Fc receptor show dramatic differences in immunoglobulin G and albumin binding.
20006594 2010 FcRn binding properties of an abnormal truncated analbuminemic albumin variant.
19772792 Association between polymorphisms in the FCGRT gene and lupus nephritis in Chinese patients.
19462839 2009 [Intracellular traffic and the immune surveillance by neonatal Fcgamma receptor for IgG].
19451275 2009 The recycling and transcytotic pathways for IgG transport by FcRn are distinct and display an inherent polarity.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19362735 2009 Functional expression of the human neonatal Fc-receptor, hFcRn, in isolated cultured human syncytiotrophoblasts.
19275696 2009 Role of Fc Receptors as a therapeutic target.
19164298 2009 N-Glycan Moieties in Neonatal Fc Receptor Determine Steady-state Membrane Distribution and Directional Transport of IgG.
18843053 2008 Neonatal Fc receptor mediates internalization of Fc in transfected human endothelial cells.
18684948 2008 The MHC class II-associated invariant chain interacts with the neonatal Fc gamma receptor and modulates its trafficking to endosomal/lysosomal compartments.
18637944 2008 Ligand binding and antigenic properties of a human neonatal Fc receptor with mutation of two unpaired cysteine residues.
18599440 2008 Dependence of antibody-mediated presentation of antigen on FcRn.
18566411 2008 Activation of the JAK/STAT-1 signaling pathway by IFN-gamma can down-regulate functional expression of the MHC class I-related neonatal Fc receptor for IgG.
18003977 2008 Ca2+-dependent calmodulin binding to FcRn affects immunoglobulin G transport in the transcytotic pathway.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17709515 2007 NF-kappaB signaling regulates functional expression of the MHC class I-related neonatal Fc receptor for IgG via intronic binding sequences.
17703228 2007 FcRn: the neonatal Fc receptor comes of age.
17674040 2007 The neonatal Fc receptor (FcRn) expression in the human skin.
17384151 2007 Elucidation of intracellular recycling pathways leading to exocytosis of the Fc receptor, FcRn, by using multifocal plane microscopy.
17048273 2006 The conserved histidine 166 residue of the human neonatal Fc receptor heavy chain is critical for the pH-dependent binding to albumin.
17046328 2007 Kinetics of FcRn-mediated recycling of IgG and albumin in human: pathophysiology and therapeutic implications using a simplified mechanism-based model.
16849638 2006 FcRn: an IgG receptor on phagocytes with a novel role in phagocytosis.
16805790 2006 A variable number of tandem repeats polymorphism influences the transcriptional activity of the neonatal Fc receptor alpha-chain promoter.
16549777 2006 Familial hypercatabolic hypoproteinemia caused by deficiency of the neonatal Fc receptor, FcRn, due to a mutant beta2-microglobulin gene.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16229888 2006 Efficient apical IgG recycling and apical-to-basolateral transcytosis in polarized BeWo cells overexpressing hFcRn.
15689494 2005 From sorting endosomes to exocytosis: association of Rab4 and Rab11 GTPases with the Fc receptor, FcRn, during recycling.
15654966 2005 Expression of FcRn, the MHC class I-related receptor for IgG, in human keratinocytes.
15644205 2005 Conferring the binding properties of the mouse MHC class I-related receptor, FcRn, onto the human ortholog by sequential rounds of site-directed mutagenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15258288 2004 Exocytosis of IgG as mediated by the receptor, FcRn: an analysis at the single-molecule level.
14767057 2004 Bidirectional transepithelial IgG transport by a strongly polarized basolateral membrane Fcgamma-receptor.
14764666 2004 Visualizing the site and dynamics of IgG salvage by the MHC class I-related receptor, FcRn.
14630397 2003 The MHC class I related Fc receptor, FcRn, is expressed in the epithelial cells of the human mammary gland.
12972260 2003 Generation of mutated variants of the human form of the MHC class I-related receptor, FcRn, with increased affinity for mouse immunoglobulin G.
12885906 2003 Endocytosis of hepatitis B immune globulin into hepatocytes inhibits the secretion of hepatitis B virus surface antigen and virions.
12566415 2003 The major histocompatibility complex-related Fc receptor for IgG (FcRn) binds albumin and prolongs its lifespan.
12538789 2003 Distribution of the IgG Fc receptor, FcRn, in the human fetal intestine.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12144784 2002 Membrane-anchored human FcRn can oligomerize in the absence of IgG.
12023961 2002 Functional reconstitution of human FcRn in Madin-Darby canine kidney cells requires co-expressed human beta 2-microglobulin.
12006623 2002 beta(2)-Microglobulin is important for cell surface expression and pH-dependent IgG binding of human FcRn.
11717196 2001 Differences in promiscuity for antibody-FcRn interactions across species: implications for therapeutic antibodies.
11207281 2001 MHC class I-related neonatal Fc receptor for IgG is functionally expressed in monocytes, intestinal macrophages, and dendritic cells.
10998088 2000 Cloning and analysis of the gene encoding the human neonatal Fc receptor.
10933786 2000 Crystal structure and immunoglobulin G binding properties of the human major histocompatibility complex-related Fc receptor(,).
9493268 1998 Structural basis of pH-dependent antibody binding by the neonatal Fc receptor.
9439449 1997 Secretory carbonic anhydrase isoenzyme (CA VI) in human serum.
8871627 1996 Isolation from human placenta of the IgG transporter, FcRn, and localization to the syncytiotrophoblast: implications for maternal-fetal antibody transport.
8646894 1996 The human gene encoding the heavy chain of the major histocompatibility complex class I-like Fc receptor (FCGRT) maps to 19q13.3.
7964511 1994 A major histocompatibility complex class I-like Fc receptor cloned from human placenta: possible role in transfer of immunoglobulin G from mother to fetus.