Property Summary

NCBI Gene PubMed Count 173
PubMed Score 1566.92
PubTator Score 207.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (20)

Disease log2 FC p
psoriasis 2.600 7.4e-03
cutaneous lupus erythematosus 1.700 4.7e-02
osteosarcoma -2.042 3.7e-02
periodontitis 1.300 8.8e-21
medulloblastoma, large-cell -1.500 1.1e-03
tuberculosis 1.800 3.7e-05
non-small cell lung cancer -1.711 6.7e-15
intraductal papillary-mucinous adenoma (... -2.500 2.2e-04
intraductal papillary-mucinous carcinoma... -2.100 1.7e-03
intraductal papillary-mucinous neoplasm ... -2.100 9.7e-03
lung cancer -2.400 1.1e-05
active Crohn's disease 1.213 2.0e-02
pancreatic cancer 1.100 1.2e-02
interstitial cystitis 3.000 1.7e-03
pilocytic astrocytoma 1.200 5.2e-04
nasopharyngeal carcinoma 1.400 3.6e-07
lung adenocarcinoma -1.371 2.4e-06
ulcerative colitis 4.300 7.1e-06
ovarian cancer -2.900 2.5e-08
dermatomyositis 2.000 4.0e-03

 GO Process (1)

 CSPA Cell Line (2)

Gene RIF (186)

PMID Text
27034964 data show that cross-linking FcgammaRIIIb is responsible for NET formation by the human neutrophil
26748351 Fc-gamma receptor polymorphisms differentially influence susceptibility to systemic lupus erythematosus and lupus nephritis.
26407570 the results of this meta-analysis indicated that low FCGR3B CN increased susceptibility to autoimmune diseases--{REVIEW}
26314337 No relationship was found between the FCGR3B polymorphism and rheumatoid arthritis susceptibility.
26032265 Data show that gains or losses in copy numbers of Fc gamma receptors FCGR3A were less frequent than for FCGR3B and FCGR2C.
25966632 our method allows determining the CNV status of the FCGR locus, we identified association of CNV in FCGR3B to RA and showed a functional relationship between CNV in the FCGR3A gene and CD16A expression.
25816339 Results show that substitution of the serine 197 in the middle of the cleavage region for a proline (S197P) blocked CD16a and CD16b cleavage when expressed in NK cells but the mutation did not disrupt IgG binding by the receptors.
25626603 This study compared the FCGR3B gene frequencies among 230 unrelated healthy Eastern Thai blood donors in Rayong hospital with the previously published studies.
25428402 in the Indian population, FCGR3B gene copy number varied significantly when compared to other populations of the world.
25345863 Data show that the recombinant Fc gamma receptors FcgammaRIa, FcgammaRIIa, FcgammaRIIb, FcgammaRIIIa(Phe158/Val158), and FcgammaRIIIb glycosylation is complex and varied between receptors.
25250834 HIV-1 Tat upregulates the expression of CCR2, CD16, and TLR4 in monocyte-derived macrophages
25154742 In Taiwanese individuals, a low FCGR3A copy number is a common risk factor for systemic lupus erythematosus (SLE) and rheumatoid arthritis (RA), while a low FCGR3B copy number confers a risk of SLE but not RA.
25024378 This suggests that FcgammaRIIIb signals in association with macrophage-1 Ag.
25012234 A high copy number of FCGR3B is associated with psoriasis vulgaris in Han Chinese.
24945596 The HNA-1b allotype influences the Fc gamma RIIIb cooperation with Fc gamma RIIa, but not with CR3.
24896836 FcgammaRIIIb polymorphism is not associated with susceptibility to systemic lupus erythematosus in Brazilian patients
24673810 FCGR3B copy number related to systemic lupus and lupus nephritis susceptibility.
24554771 Data suggest that the early phase of IgG-mediated neutrophil reactivity is influenced by FCGR2/3 genotypic variation.
24205492 The frequencies of FCGR3B*1, FCGR3B*2, and FCGR3B*3 alleles in central Thai blood donors were 0.548, 0.452, and 0.004.
24191245 The genotypic frequency of the H/R genotype of FcgammaRIIA and the NA1/NA1 genotype of FcgammaRIIIB was significantly decreased in patients compared to normals (P-0.0074, P-0.0471, resp.).
23935200 The absolute risk of malaria decreased more rapidly with increasing antibody levels for Fc gamma receptor 3B 233AA/AC individuals compared with 233CC children.
23917248 Copy number of polymorphisms in FCGR3B gene is associated with ulcerative colitis.
23778324 study concludes gene copy number of FcgammaR2C and FcgammaR3B influences IVIG treatment response and predisposes individuals to Kawasaki disease, providing potential insights into understanding the mechanism of the FcgammaR gene family in the IVIG pathway
23649770 The FCGR3B NA1/NA2 polymorphism may be associated with susceptibility to aggressive periodontitis.
23398146 Allele frequencies were determined in the blood donor population as follows: 0.318 for HNA-1a, 0.668 for HNA-1b, 0.014 for HNA-1c, 0.768 for HNA-3a, 0.232 for HNA-3b, 0.882 for HNA-4a, 0.118 for HNA-4b, 0.736 for HNA-5a and 0.264 for HNA-5b.
23281059 Higher CD16+ cytotoxic NK+T lymphocyte levels predict superior survival outcomes in patients with metastatic carcinoma.
23261299 We conclude that FCGR3B deletion juxtaposes the 5'-regulatory sequences of FCGR2C with the coding sequence of FCGR2B.
23049979 The FcgammaRIIIB-SH allotype (CTGAAA) containing the 233A-allele (in bold) was associated with protection from malaria. The FcgammaRIIIB-NA2*03 allotype (CTGCGA), a variant of the classical FcgammaRIIIB-NA2 (CTGCAA) was associated with susceptibility to malaria.
22999728 CD14++CD16+ monocytes independently predicted cardiovascular events in subjects referred for elective coronary angiography.
22942264 Low copy number of the Fc-gamma receptor 3B gene FCGR3B is a risk factor for primary Sjogren's syndrome.
22837109 Studies indicate beta-defensins (DEFB4, DEFB103, DEFB104), chemokine ligand 3 like 1 (CCL3L1), Fc gamma receptor 3B (FCGR3B), and complement component C4 (C4) for copy number variation in disease association.
22770404 Both ADAM10 and ADAM17 could shed CD16b, but they possess differed preferences. ADAM10 is the main sheddase under stimulation of ionomycin, while ADAM17 is the main sheddase under stimulation of PMA.
22565545 The FcgammaRIIIB-NA1 variant, which confers higher affinity for IgG than the NA2 variant, is a determining factor for treatment response.
22551723 suggest that impaired immune complex clearance arising from FCGR3B deficiency contributes to the pathology of systemic sclerosis, and FCGR3B copy number variation is a common risk factor for systemic autoimmunity
22512913 FCGR3B*1, FCGR3B*2 and FCGR3B*3 allele frequencies were respectively 0.347, 0.573 and 0.080 among Tunisians of sub-Saharan origin, 0.379, 0.591 and 0.030 among Tunisian blood donors and 0.318, 0.546 and 0.136 among the group from sub-Saharan Africa.
22309893 Study indicates that a low copy number of the FCGR3B gene is associated with susceptibility to rheumatoid arthritis (RA).
22290871 association of FCGR3B but not FCGR3A copy number with susceptibility to autoantibody positive rheumatoid arthritis
22167032 NA2/NA2 and/or NA2 allele may be risk factors for generalized aggressive periodontitis in the population of South India
21937707 Monocyte subsets have specialized roles during inflammation: CD16-positive monocytes might undergo an immediate innate immune response, whereas CD16-negative monocytes could have a major role as antigen presenting cells.
21895673 In this Brazilian FCGR3B*03(+) group we found that the inheritance of FCGR3B*03 took place by a linkage to FCGR3B*02 or to FCGR3B*01.
21832933 HIV-1 Tat upregulates the expression of CCR2, CD16, and TLR4 in monocyte-derived macrophages
21818580 Results here demonstrate that variation in the FcgammaR gene alters susceptibility to repeated episodes of SMA and mortality, as well as functional changes in IFN-gamma production.
21296850 FCGR3B DNA copy number variation is associated with systemic lupus erythematosus risk in afro-caribbeans.
21227406 IL-21 stimulates the production of IL-10 by CD4(+) T-cells. Secreted Il-10 maintains the expression of CD16 on monocytes.
21123174 the neutrophil responses to stimuli that engage FcGR3B and FcGR2A, namely the phagocytosis of human IgG-opsonized zymosan and the responses to heat-aggregated IgGs
21109729 copy number associated with susceptibility to idiopathic pulmonary fibrosis
20980704 The FCGR3B NA1/NA1 genotype was found in 75% of the patients with infusion reactions and in only 37% of those without (p=0.01), whereas the FCGR3A 176F/V genotype was equally distributed in the patients with or without infusion reactions.
20980704 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20957197 study highlights the complexity and poor characterization of the FCGR3B gene sequence, indicating that the design and interpretation of genotyping assays based on specific probe sequences must be performed with caution
20957197 Observational study of gene-disease association. (HuGE Navigator)
20924590 FcgammaRIIIb NA1/2 polymorphisms are associated with idiopathic pulmonary fibrosis disease susceptibility but not with disease progression.
20924590 Observational study of gene-disease association. (HuGE Navigator)
20720565 FcgammRIIA and FcgammaRIIIB are required for neutrophil mediated dermal epidermal separation in bullous pemphigoid
20707220 Observational study of gene-disease association. (HuGE Navigator)
20664961 Data suggestd that the loss of the CD16 B73.1/Leu11c binding epitope is connected with primary immunodeficiency disorders, but not associated with the FcgammaRIIIa-48 polymorphism.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20536598 The primary involvement of Fc gamma R IIIB NA2 allele is more likely involved with disease susceptibility of systemic lupus erythematosus.
20536598 Observational study of gene-disease association. (HuGE Navigator)
20508037 Data show that CN of FCGR3B and variations in are important in SLE pathogenesis.
20508037 Observational study of gene-disease association. (HuGE Navigator)
20472591 Significant evidence for an association between copy number and rheumatoid arthritis was observed in the Dutch cohort but not in the two smaller cohorts (New Zealand and United Kingdom populations, respectively).
20472591 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20442749 results, obtained by fitting logistic regression models, confirm the association of low copy number of FCGR3B with systemic lupus erythematosus
20442749 Observational study of gene-disease association. (HuGE Navigator)
20439936 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20367096 Observational study of gene-disease association. (HuGE Navigator)
20364047 differences in monocyte CD14CD16 expansion represent an important tool for exploring the role of selective inflammatory pathways in heart failure progression
20356573 FcgammaRIIIB could mediate phagocytosis in human neutrophils but much less efficiently than FcgammaRIIA
20300756 Our results suggest that FcgammaRIIIb might not be a susceptibility gene for SLE and lupus nephritis.
20300756 Meta-analysis of gene-disease association. (HuGE Navigator)
20149216 The Fcggamma RIIIB NA1/NA2 polymorphism was associated with both aggressive and chronic periodontitis (review).
20149216 Meta-analysis of gene-disease association. (HuGE Navigator)
20133350 Observational study of gene-disease association. (HuGE Navigator)
20041976 Results of the present study suggest that subjects carrying at least one copy of the FcgammaRIIIb-NA2 allele might be associated with susceptibility to aggressive periodontitis.
20041976 Observational study of gene-disease association. (HuGE Navigator)
19946035 The data suggest that FCGR3B CNV was not associated with lupus nephritis development or progression in this Chinese population
19946035 Observational study of gene-disease association. (HuGE Navigator)
19946017 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19892918 Observational study of gene-disease association. (HuGE Navigator)
19741716 Association of gene dosage variation in the FCGR3B gene with risk of autoimmune diseases is reported.
19741716 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19720214 carriage of allele H131 of the FcgammaRIIa gene and a combination of this allele with allele NA2 of the FcgammaRIIIb gene might influence the patient's response to endodontic treatment of teeth with apical periodontitis
19640933 Observational study of gene-disease association. (HuGE Navigator)
19502269 Observational study of gene-disease association. (HuGE Navigator)
19497711 Observational study of gene-disease association. (HuGE Navigator)
19342628 FcgammaRIIIB, but not FcgammaRIIA, activates a unique signaling pathway leading to the nuclear-restricted phosphorylation of ERK and Elk-1, independently of Syk, PI3K, or MEK
19320901 Evidence for gene recombination in FCGR3 gene variants.
19317341 FCGR3B gene variants are differentially transcribed between cell types and tissues, increasing the likelihood of the presence of variant FcgammaRIII receptors on the cell surface.
19309690 Only FCGR3A, FCGR2C and FCGR3B show copy number variation, in contrast to FCGR2A and FCGR2B.
19218011 the nonfucosylated anti-CD20 effectively enhanced neutrophil phagocytosis solely by enhancing binding for the phagocytosis coreceptor FcgammaRIIIb
19201911 Our results challenge the two dogmas 1) that basophils do not express FcgammaRIII and 2) that FcgammaRIIIB is exclusively expressed by neutrophils.
19100392 Observational study of gene-disease association. (HuGE Navigator)
19026120 the genotype frequencies and allelic distributions of the Fcgamma R (receptor)IIa, FcgammaRIIIa and FcgammaRIIIb gene polymorphisms were significantly different between BD patients and healthy controls and associated with disease severity, age of onset
19026120 Observational study of gene-disease association. (HuGE Navigator)
18843786 Meta-analysis of gene-disease association. (HuGE Navigator)
18559452 Copy number of FCGR3B, which is associated with systemic lupus erythematosus, correlates with protein expression and immune complex uptake
18452102 Promoter polymorphisms of FCGR2A, FCGR3A and FCGR3B were not convincingly associated with infections after chemotherapy and stem cell transplantation in multiple myeloma.
18452102 Observational study of gene-disease association. (HuGE Navigator)
18408222 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18372357 Observational study of gene-disease association. (HuGE Navigator)
18156711 Observational study of genotype prevalence. (HuGE Navigator)
18052703 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17847104 Observational study of gene-disease association. (HuGE Navigator)
17847104 Fcgr3b genotype influences the disease susceptibility and severity of IgA nephropathy in Chinese.
17710620 Observational study of gene-disease association. (HuGE Navigator)
17710620 The FCGR2A 131RR and FCGR3A 158VV genotypes were over-represented [OR: 1.67 (1.05-2.63) and 2.04 (1.06-4.00), respectively] whereas the FCGR3B NA2NA2 was under-represented in patients with cryptococcosis (28% vs. 40% in controls).
17596285 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17584599 Observational study of gene-disease association. (HuGE Navigator)
17584599 FcgammaRIIIb NA1/NA2 heterozygote genotype frequency was increased in end stage renal disease (ESRD) patients in Chinese; present findings showed that FcgammaRIIIb genotype is related to ESRD susceptibility
17529978 FCGR3B deficiency is associated with systemic lupus erythematosus, microscopic polyangiitis and Wegener's granulomatosis
17523948 Observational study of gene-disease association. (HuGE Navigator)
17335370 Observational study of gene-disease association. (HuGE Navigator)
16899095 Observational study of gene-disease association. (HuGE Navigator)
16889631 Observational study of gene-disease association. (HuGE Navigator)
16805673 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16598772 FcgammaRIIIb acts as a membrane adaptor for PR3
16550341 Observational study of gene-disease association. (HuGE Navigator)
16542359 Observational study of gene-disease association. (HuGE Navigator)
16482158 In humans, low copy number of FCGR3B, an orthologue of rat Fcgr3, was associated with glomerulonephritis in the autoimmune disease systemic lupus erythematosus.
16467081 The expression of CD16 predicts the functional capacity of NK cells infiltrating renal cell carcinoma and can be used to characterize subgroups of renal cell carcinoma.
16356189 Observational study of gene-disease association. (HuGE Navigator)
16356189 Increased association with an FCGR3A-FCGR3B haplotype suggests that other polymorphic variants or in linkage disequilibrium may also contribute to rheumatoid arthritis pathogenesis.
16171455 High-density detergent-resistant membranes play a role in CD16b signalling in human neutrophils.
16160618 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16155708 Observational study of gene-disease association. (HuGE Navigator)
16133986 Observational study of gene-disease association. (HuGE Navigator)
16110781 Observational study of gene-disease association. (HuGE Navigator)
15974849 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15974849 results may suggest an association between smoking and periodontal disease progression in elderly people with NA2 polymorphism
15946259 Observational study of genotype prevalence. (HuGE Navigator)
15934433 Observational study of gene-disease association. (HuGE Navigator)
15934433 Although FcgammaRIIIB polymorphism was not associated with the development of SLE in Korean, thrombocytopenia was associated with FcgammaRIIIB NA2/NA2 genotype, and NA2 allele.
15910853 Observational study of gene-disease association. (HuGE Navigator)
15889368 We found a total deficiency of FcgammaRIIIb on neutrophils, which could partially explain the unusually severe clinical presentation of meningococcal septic shock
15833371 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
15833371 Results suggest that Fc gammaRIII genotypes may represent mild disease-modifying factors in GBS.
15783303 Observational study of genotype prevalence. (HuGE Navigator)
15713217 Observational study of genotype prevalence. (HuGE Navigator)
15713217 Variation in the FcgammaR3B gene is associated with distinct Brazilian populations
15526004 Observational study of gene-disease association. (HuGE Navigator)
15500735 Observational study of genotype prevalence. (HuGE Navigator)
15457442 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15369725 Observational study of gene-disease association. (HuGE Navigator)
15369725 FcgammaRIIIB gene polymorphisms is associated with rheumatic fever
15245367 The FCGR3B receptor is constituted by a unique FCGR3B polypeptide chain.
15194589 Observational study of gene-disease association. (HuGE Navigator)
15152814 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14761117 Observational study of gene-disease association. (HuGE Navigator)
14740435 Observational study of gene-disease association. (HuGE Navigator)
14651519 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
14634123 Homotypic cross-linking of neutrophil Fc gamma RIIIb results in significant release of alpha-defensins capable of recruiting mononuclear, dendritic, and T cells to antineutrophil cytoplasmic antibody (ANCA)-induced granuloma.
14597109 Observational study of gene-disease association. (HuGE Navigator)
12898191 Observational study of genotype prevalence. (HuGE Navigator)
12898191 it is concluded that the FCGR3B*1(Fc fragment of IgG, low affinity IIIb receptor for CD16) gene is the more frequent variant in a Chinese population from Zhejiang Province
12867584 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12864991 Observational study of gene-disease association. (HuGE Navigator)
12864991 Polymorphism of the Fc gamma IIIb receptor influences neither susceptibility nor clinical disease course of multiple sclerosis.
12858454 Observational study of gene-disease association. (HuGE Navigator)
12839649 Observational study of gene-disease association. (HuGE Navigator)
12834496 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12830330 Observational study of genotype prevalence. (HuGE Navigator)
12753656 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12753656 Fcgamma receptor IIIb polymorphisms are associated with susceptibility to systemic lupus erythematosus in Thais
12710759 Observational study of gene-disease association. (HuGE Navigator)
12501257 Observational study of gene-disease association. (HuGE Navigator)
12486608 Observational study of gene-disease association. (HuGE Navigator)
12447772 Observational study of gene-disease association. (HuGE Navigator)
12445195 expression of mRNA specific for the FcgammaRIIIA and FcgammaRIIIB subclasses are upregulated by interferon-gamma on human keratinocytes
12421634 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12393699 Observational study of gene-disease association. (HuGE Navigator)
12176802 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12121275 Observational study of gene-disease association. (HuGE Navigator)
12115243 Differential role of neutrophil Fcgamma receptor IIIB (CD16) in phagocytosis, bacterial killing, and responses to immune complexes.
12076295 Observational study of genotype prevalence. (HuGE Navigator)
12064825 Observational study of gene-disease association. (HuGE Navigator)
12027254 Observational study of gene-disease association. (HuGE Navigator)
11897993 expression of FcgammaRIIIB on human peripheral blood eosinophils increases in allergic conditions
11835346 Observational study of gene-disease association. (HuGE Navigator)
11740730 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11699473 Observational study of gene-disease association. (HuGE Navigator)
11528518 Observational study of gene-disease association. (HuGE Navigator)
11379895 Observational study of gene-disease association. (HuGE Navigator)
11099670 Observational study of genotype prevalence. (HuGE Navigator)
9743356 HIV-1 Tat upregulates the expression of CCR2, CD16, and TLR4 in monocyte-derived macrophages

AA Sequence

MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQ      1 - 70
ASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVT     71 - 140
YLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVS    141 - 210
FCLVMVLLFAVDTGLYFSVKTNI                                                   211 - 233
//

Text Mined References (174)

PMID Year Title
27034964 2016 Differential Use of Human Neutrophil Fc? Receptors for Inducing Neutrophil Extracellular Trap Formation.
26748351 2016 Fc-gamma receptor polymorphisms differentially influence susceptibility to systemic lupus erythematosus and lupus nephritis.
26407570 2015 Association between FCGR3B copy number variations and susceptibility to autoimmune diseases: a meta-analysis.
26314337 FCGR2A, FCGR3A, FCGR3B polymorphisms and susceptibility to rheumatoid arthritis: a meta-analysis.
26032265 2015 Allelic and copy-number variations of Fc?Rs affect granulocyte function and susceptibility for autoimmune blistering diseases.
25966632 2016 Association analysis of copy numbers of FC-gamma receptor genes for rheumatoid arthritis and other immune-mediated phenotypes.
25816339 2015 Identification of an ADAM17 cleavage region in human CD16 (Fc?RIII) and the engineering of a non-cleavable version of the receptor in NK cells.
25626603 2015 FCGR3B gene frequencies among ethnic Thai blood donors from a regional hospital in Eastern Thailand.
25428402 2015 Frequency distribution of autoimmunity associated FCGR3B gene copy number in Indian population.
25345863 2014 Fc gamma receptor glycosylation modulates the binding of IgG glycoforms: a requirement for stable antibody interactions.
25154742 2014 Association of FCGR3A and FCGR3B copy number variations with systemic lupus erythematosus and rheumatoid arthritis in Taiwanese patients.
25024378 2014 Immobilized immune complexes induce neutrophil extracellular trap release by human neutrophil granulocytes via Fc?RIIIB and Mac-1.
25012234 2014 A high copy number of FCGR3B is associated with psoriasis vulgaris in Han Chinese.
24945596 2014 Influence of Fc?RIIIb polymorphism on its ability to cooperate with Fc?RIIa and CR3 in mediating the oxidative burst of human neutrophils.
24896836 2014 Fc?RIIa and Fc?RIIIb polymorphisms and associations with clinical manifestations in systemic lupus erythematosus patients.
24673810 2015 FCGR3B copy number loss rather than gain is a risk factor for systemic lupus erythematous and lupus nephritis: a meta-analysis.
24554771 2014 Haplotypes of Fc?RIIa and Fc?RIIIb polymorphic variants influence IgG-mediated responses in neutrophils.
24205492 2013 Frequency of FCGR3B alleles in Thai blood donors.
24191245 2013 The Fc receptor polymorphisms and expression of neutrophil activation markers in patients with sickle cell disease from Western India.
23935200 2014 Fc gamma receptor 3B (FCGR3B-c.233C>A-rs5030738) polymorphism modifies the protective effect of malaria specific antibodies in Ghanaian children.
23917248 2013 Impact of allele copy number of polymorphisms in FCGR3A and FCGR3B genes on susceptibility to ulcerative colitis.
23778324 2013 Fc?R gene copy number in Kawasaki disease and intravenous immunoglobulin treatment response.
23649770 2013 Associations between FCGR2A rs1801274, FCGR3A rs396991, FCGR3B NA1/NA2 polymorphisms and periodontitis: a meta-analysis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23398146 2013 Determination of human neutrophil antigen-1, -3, -4 and -5 allele frequencies in English Caucasoid blood donors using a multiplex fluorescent DNA-based assay.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23281059 2013 The extended leukocyte differential count using the Cytodiff flow cytometric system reveals that higher CD16+ cytotoxic NK+T lymphocyte levels predict superior survival outcomes in patients with metastatic carcinoma.
23261299 2013 Genomic pathology of SLE-associated copy-number variation at the FCGR2C/FCGR3B/FCGR2B locus.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23049979 2012 Fc ? receptor IIIB (Fc?RIIIB) polymorphisms are associated with clinical malaria in Ghanaian children.
22999728 2012 CD14++CD16+ monocytes independently predict cardiovascular events: a cohort study of 951 patients referred for elective coronary angiography.
22942264 2012 Low copy number of the Fc-? receptor 3B gene FCGR3B is a risk factor for primary Sjogren's syndrome.
22837109 2013 Correlating multiallelic copy number polymorphisms with disease susceptibility.
22770404 2012 Role of ADAM10 and ADAM17 in CD16b shedding mediated by different stimulators.
22565545 2012 Role of activating Fc?R gene polymorphisms in Kawasaki disease susceptibility and intravenous immunoglobulin response.
22551723 2012 Evidence that deletion at FCGR3B is a risk factor for systemic sclerosis.
22512913 2012 FCGR3B allele frequencies in Tunisians of sub-Saharan origin.
22309893 2012 Low copy number of the FCGR3B gene and rheumatoid arthritis: a case-control study and meta-analysis.
22290871 2012 Confirmation of association of FCGR3B but not FCGR3A copy number with susceptibility to autoantibody positive rheumatoid arthritis.
22167032 2011 Genetic polymorphism of Fc?-receptors IIa, IIIa and IIIb in South Indian patients with generalized aggressive periodontitis.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21937707 2011 Human CD16+ and CD16- monocyte subsets display unique effector properties in inflammatory conditions in vivo.
21895673 2012 FCGR3B*03 allele inheritance pattern in Brazilian families and some new variants of gene FCGR3B.
21818580 2012 Functional haplotypes of Fc gamma (Fc?) receptor (Fc?RIIA and Fc?RIIIB) predict risk to repeated episodes of severe malarial anemia and mortality in Kenyan children.
21296850 2011 FCGR3B copy number variation is associated with systemic lupus erythematosus risk in Afro-Caribbeans.
21227406 2011 Interleukin-21 maintains the expression of CD16 on monocytes via the production of IL-10 by human naïve CD4+ T cells.
21123174 2011 Fc gammaRIIIb triggers raft-dependent calcium influx in IgG-mediated responses in human neutrophils.
21109729 2011 Copy number variation of FCGR3B is associated with susceptibility to idiopathic pulmonary fibrosis.
20980704 2011 Fc? receptor IIIb polymorphism and use of glucocorticoids at baseline are associated with infusion reactions to infliximab in patients with rheumatoid arthritis.
20957197 2010 Genetic variation of the Fc gamma receptor 3B gene and association with rheumatoid arthritis.
20924590 2010 Fc? receptor IIIb (CD16b) polymorphisms are associated with susceptibility to idiopathic pulmonary fibrosis.
20720565 2010 Fc?RIIA and Fc?RIIIB are required for autoantibody-induced tissue damage in experimental human models of bullous pemphigoid.
20707220 2009 Functional polymorphisms of PTPN22 and FcgR genes in Tunisian patients with rheumatoid arthritis.
20664961 2010 The loss of the CD16 B73.1/Leu11c epitope occurring in some primary immunodeficiency diseases is not associated with the FcgammaRIIIa-48L/R/H polymorphism.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20536598 2010 Fc gamma R IIIB polymorphisms: their association with clinical manifestations and autoantibodies in SLE patients from western India.
20508037 2010 Copy number, linkage disequilibrium and disease association in the FCGR locus.
20472591 2010 Association of variation in Fcgamma receptor 3B gene copy number with rheumatoid arthritis in Caucasian samples.
20442749 2010 Evidence for both copy number and allelic (NA1/NA2) risk at the FCGR3B locus in systemic lupus erythematosus.
20439936 2010 SNPs of Fc-gamma receptor genes and chronic periodontitis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20367096 2010 Genetic variants associated with neutrophil function in aggressive periodontitis and healthy controls.
20364047 2010 CD14CD16 monocyte subset levels in heart failure patients.
20356573 2010 Fcgamma receptors exhibit different phagocytosis potential in human neutrophils.
20300756 2011 Lack of association of Fc?RIIIb polymorphisms with systemic lupus erythematosus: a meta-analysis.
20149216 2010 Fcgamma receptor polymorphisms and their association with periodontal disease: a meta-analysis.
20133350 2010 The single nucleotide polymorphisms gene but not the copy number variation of Fcgr3B is associated with lupus nephritis in Chinese people.
20041976 2010 The association of Fcgamma receptor IIIb genetic polymorphism and susceptibility to periodontitis in Taiwanese individuals.
19946035 2010 FCGR3B copy number variation is not associated with lupus nephritis in a Chinese population.
19946017 2010 Copy number variation of FCGR3A rather than FCGR3B and FCGR2B is associated with susceptibility to anti-GBM disease.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19892918 2009 Genetic risk factors for periodontitis in a Japanese population.
19741716 2010 Association of copy number variation in the FCGR3B gene with risk of autoimmune diseases.
19720214 2009 Relationship between Fcgamma receptor and interleukin-1 gene polymorphisms and post-treatment apical periodontitis.
19640933 2010 FCGR2B gene polymorphism rather than FCGR2A, FCGR3A and FCGR3B is associated with anti-GBM disease in Chinese.
19502269 2009 Fcgamma receptor IIB and IIIB polymorphisms and susceptibility to systemic lupus erythematosus and lupus nephritis: a meta-analysis.
19497711 2009 Assessment of 14 functional gene polymorphisms in Japanese patients with oral lichen planus: a pilot case-control study.
19342628 2009 FcgammaRIIA and FcgammaRIIIB mediate nuclear factor activation through separate signaling pathways in human neutrophils.
19320901 2009 Evidence for gene recombination in FCGR3 gene variants.
19317341 2008 Variant FCGR3 genes: transcription and possible origins.
19309690 2009 Copy number variation at the FCGR locus includes FCGR3A, FCGR2C and FCGR3B but not FCGR2A and FCGR2B.
19218011 2009 Nonfucosylated rituximab potentiates human neutrophil phagocytosis through its high binding for FcgammaRIIIb and MHC class II expression on the phagocytotic neutrophils.
19201911 2009 Human basophils express the glycosylphosphatidylinositol-anchored low-affinity IgG receptor FcgammaRIIIB (CD16B).
19100392 2008 The role of fcgamma receptor gene polymorphism in pediatric renal transplant rejections.
19026120 FcgammaRIIa, IIIa and IIIb gene polymorphisms in Behçet's disease: do they have any clinical implications?
18843786 2008 Associations between FCGR3A polymorphisms and susceptibility to rheumatoid arthritis: a metaanalysis.
18559452 2008 Copy number of FCGR3B, which is associated with systemic lupus erythematosus, correlates with protein expression and immune complex uptake.
18452102 2008 Infectious complications after chemotherapy and stem cell transplantation in multiple myeloma: implications of Fc gamma receptor and myeloperoxidase promoter polymorphisms.
18408222 2008 Neutrophil role in in vivo anti-lymphoma activity of rituximab: FCGR3B-NA1/NA2 polymorphism does not influence response and survival after rituximab treatment.
18372357 2008 Time to seizure occurrence and damage in PROFILE, a multi-ethnic systemic lupus erythematosus cohort.
18156711 2006 Gene frequencies of human neutrophil antigens 4a and 5a in the korean population.
18052703 2007 The interleukin-1 and Fcgamma receptor gene polymorphisms in Japanese patients with rheumatoid arthritis and periodontitis.
17847104 2007 NA1/NA2 heterozygote of Fcgr3b is a risk factor for progression of IgA nephropathy in Chinese.
17710620 2007 Study of common functional genetic polymorphisms of FCGR2A, 3A and 3B genes and the risk for cryptococcosis in HIV-uninfected patients.
17596285 2007 Association between SLE nephritis and polymorphic variants of the CRP and FcgammaRIIIa genes.
17584599 2007 Association of Fc gamma receptor IIIB polymorphism with renal-allogrft in Chinese.
17529978 2007 FCGR3B copy number variation is associated with susceptibility to systemic, but not organ-specific, autoimmunity.
17523948 2007 Fc-gamma receptor polymorphisms are not associated with autoimmune Addison's disease.
17335370 2007 The combined genotypes of stimulatory and inhibitory Fc gamma receptors associated with systemic lupus erythematosus and periodontitis in Japanese adults.
16899095 2006 NADPH oxidase (CYBA) and FcgammaR polymorphisms as risk factors for aggressive periodontitis: a case-control association study.
16889631 2006 Fcgamma receptor polymorphisms and periodontal status: a prospective follow-up study.
16805673 2006 Distribution of FcgammaRIIa and FcgammaRIIIb genotypes in patients with generalized aggressive periodontitis.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16598772 2006 Membrane proteinase 3 and its interactions within microdomains of neutrophil membranes.
16550341 2006 Fc gamma RIIa, IIIa and IIIb polymorphisms in Turkish children susceptible to recurrent infectious diseases.
16542359 2006 Association of rheumatoid factor production with FcgammaRIIIa polymorphism in Taiwanese rheumatoid arthritis.
16482158 2006 Copy number polymorphism in Fcgr3 predisposes to glomerulonephritis in rats and humans.
16467081 2006 Cytotoxic markers and frequency predict functional capacity of natural killer cells infiltrating renal cell carcinoma.
16356189 2006 Analysis of Fcgamma receptor haplotypes in rheumatoid arthritis: FCGR3A remains a major susceptibility gene at this locus, with an additional contribution from FCGR3B.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16171455 2006 CD16b associates with high-density, detergent-resistant membranes in human neutrophils.
16160618 2005 Drug-induced agranulocytosis: impact of different fcgamma receptor polymorphisms?
16155708 2005 [Analysis of FcgammaRIIIb genotype of periodontal disease in the Han nationality in China].
16133986 2005 Polymorphism of Fc gamma RIIa may affect the efficacy of gamma-globulin therapy in Kawasaki disease.
16110781 2005 Common polymorphisms in critical genes of innate immunity do not contribute to the risk for chronic disseminated candidiasis in adult leukemia patients.
15974849 2005 FcgammaRIIIb genotypes and smoking in periodontal disease progression among community-dwelling older adults in Japan.
15946259 2005 Ethnic variation of Fc gamma receptor polymorphism in Sami and Norwegian populations.
15934433 2005 The association between fcgammaRIIIB polymorphisms and systemic lupus erythematosus in Korea.
15910853 2005 Fcgamma receptor IIIA polymorphism as a risk-factor for coronary artery disease.
15889368 2005 FcgammaRIIIb and complement component C7 codeficiency in a patient with recurrence of fulminant meningococcal septic shock.
15833371 2005 Severity of Guillain-Barré syndrome is associated with Fc gamma Receptor III polymorphisms.
15783303 2005 FCGR3B polymorphism in three ethnic Chinese populations.
15713217 2005 Variation in the FcgammaR3B gene among distinct Brazilian populations.
15526004 2004 Genetic risk factors for infection in patients with early rheumatoid arthritis.
15500735 2004 [FCGR3B gene frequencies and FCGR3 gene variants in Chinese: a study in 487 Chinese individuals from Zhejiang Province].
15457442 2004 The influence of genetic variation in the HLA-DRB1 and LTA-TNF regions on the response to treatment of early rheumatoid arthritis with methotrexate or etanercept.
15369725 2004 Involvement of immunoglobulin FcgammaRIIA and FcgammaRIIIB gene polymorphisms in susceptibility to rheumatic fever.
15245367 2004 Characterization of human FCGR3B*02 (HNA-1b, NA2) cDNAs and IMGT standardized description of FCGR3B alleles.
15194589 2004 Fcgamma receptor IIa, IIIa, and IIIb polymorphisms of systemic lupus erythematosus in Taiwan.
15152814 2004 Association of Fcgamma receptor IIa genotype with chronic periodontitis in Caucasians.
14761117 2003 Gm (23) allotypes and Fcgamma receptor genotypes as risk factors for various forms of periodontitis.
14740435 Study of host and virological factors of patients with chronic HCV infection and associated laboratory or clinical autoimmune manifestations.
14651519 2004 Association of Fcgamma receptor IIb polymorphism with susceptibility to systemic lupus erythematosus in Chinese: a common susceptibility gene in the Asian populations.
14634123 2003 Fc gamma RIIIb allele-sensitive release of alpha-defensins: anti-neutrophil cytoplasmic antibody-induced release of chemotaxins.
14597109 2003 Association of the Fc gamma receptor IIA-R/R131 genotype with myasthenia gravis in Dutch patients.
12898191 2003 FCGR3B gene frequencies and FCGR3 variants in a Chinese population from Zhejiang Province.
12867584 2003 Independent association of HLA-DR and FCgamma receptor polymorphisms in Korean patients with systemic lupus erythematosus.
12864991 2003 No association of Fc gamma RIIa, Fc gamma RIIIa and Fc gamma RIIIb polymorphisms with MS.
12858454 2003 Genetic background of Japanese patients with antineutrophil cytoplasmic antibody-associated vasculitis: association of HLA-DRB1*0901 with microscopic polyangiitis.
12839649 2003 [Relevance of FcgammaRIIIb genotype, IgG G2m(23) factor to the susceptibility of aggressive periodontitis].
12834496 2003 Fcgamma receptor polymorphisms in relation to periodontitis.
12830330 2003 Evidence for non-random distribution of Fcgamma receptor genotype combinations.
12753656 2003 Association of Fcgamma receptor IIb and IIIb polymorphisms with susceptibility to systemic lupus erythematosus in Thais.
12710759 2003 Risk of periodontitis in systemic lupus erythematosus is associated with Fcgamma receptor polymorphisms.
12501257 2002 Absence of association between the Fc gamma receptor IIIA-176F/V polymorphism and the severity of malaria in Thai.
12486608 2002 Studies on the association of Fc gamma receptor IIA, IIB, IIIA and IIIB polymorphisms with rheumatoid arthritis in the Japanese: evidence for a genetic interaction between HLA-DRB1 and FCGR3A.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12447772 2002 Fcgamma receptor IIIA polymorphism as a risk factor for acute poliomyelitis.
12445195 2002 FcgammaRIII expression on cultured human keratinocytes and upregulation by interferon-gamma.
12421634 2002 Fcgamma receptor IIA and IIIB polymorphisms are associated with susceptibility to cerebral malaria.
12393699 2002 Host defense and inflammatory gene polymorphisms are associated with outcomes after HLA-identical sibling bone marrow transplantation.
12176802 2002 Fcgamma receptor IIa, IIIa, and IIIb polymorphisms in German patients with systemic lupus erythematosus: association with clinical symptoms.
12121275 2002 FcgammaRIIA, FcgammaRIIIA and FcgammaRIIIB polymorphisms in Spanish patients with systemic lupus erythematosus.
12076295 2002 FCGR3 variants and expression of human neutrophil antigen-1a, -1b, and -1c in the populations of northern Germany and Uganda.
12064825 2002 Immunoglobulin G fc-receptor (FcgammaR) IIA, IIIA, and IIIB polymorphisms related to disease severity in rheumatoid arthritis.
12027254 2002 Fc gamma receptor genes as risk markers for localized aggressive periodontitis in African-Americans.
11835346 2002 Patterns of low-affinity immunoglobulin receptor polymorphisms in stroke and homozygous sickle cell disease.
11740730 2001 Relevance of Fcgamma receptor and interleukin-10 polymorphisms for meningococcal disease.
11699473 2001 The Fc gamma receptor genotype as a severity factor for chronic periodontitis in Japanese patients.
11528518 2001 Polymorphisms of Fc gamma-receptors RIIa, RIIIa, and RIIIb in patients with adult periodontal diseases.
11379895 2001 Increased frequency of FcgammaRIIIb-NA1 allele in periodontitis-resistant subjects in an elderly Japanese population.
11099670 2000 Allelic polymorphisms of human fcgamma receptor IIa and Fcgamma receptor IIIb among distinct groups in Brazil.
11034564 2000 Nucleotide sequence of a new Fc gamma receptor IIIB allele that codes for a neutrophil antigen.
11021536 2000 Crystal structure of the extracellular domain of a human Fc gamma RIII.
10917521 2000 The 3.2-A crystal structure of the human IgG1 Fc fragment-Fc gammaRIII complex.
9743356 1998 HIV-1 Tat inhibits human natural killer cell function by blocking L-type calcium channels.
9028335 1997 Characterization of a new alloantigen (SH) on the human neutrophil Fc gamma receptor IIIb.
8940055 1996 Separate promoters from proximal and medial control regions contribute to the natural killer cell-specific transcription of the human FcgammaRIII-A (CD16-A) receptor gene.
7836402 1995 The human low affinity immunoglobulin G Fc receptor III-A and III-B genes. Molecular characterization of the promoter regions.
2967436 1988 The Fc gamma receptor of natural killer cells is a phospholipid-linked membrane protein.
2526846 1989 Alternative membrane forms of Fc gamma RIII(CD16) on human natural killer cells and neutrophils. Cell type-specific expression of two genes that differ in single nucleotide substitutions.
2525780 1989 A human immunoglobulin G receptor exists in both polypeptide-anchored and phosphatidylinositol-glycan-anchored forms.
2521732 1989 Human Fc gamma RIII: cloning, expression, and identification of the chromosomal locus of two Fc receptors for IgG.
2139735 1990 Organization of the human and mouse low-affinity Fc gamma R genes: duplication and recombination.