Property Summary

NCBI Gene PubMed Count 440
PubMed Score 811.50
PubTator Score 588.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
inflammatory breast cancer 1.100 1.8e-02
lung carcinoma -3.200 1.5e-31
mucosa-associated lymphoid tissue lympho... 2.254 1.7e-02

 GO Function (1)

 CSPA Cell Line (2)

Protein-protein Interaction (11)

Gene RIF (467)

AA Sequence

MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPES      1 - 70
DSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIM     71 - 140
LRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSM    141 - 210
GSSSPMGIIVAVVIATAVAAIVAAVVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNND    211 - 280
YETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN                                     281 - 317
//

Text Mined References (446)

PMID Year Title