Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.20
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 1.5e-20

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.500 1.5e-20

Gene RIF (6)

PMID Text
21832933 IgG2 and IgG4 bind more poorly to enzymatically deglycosylated recombinant gp120 (rgp120) than to unchanged rgp120
21135020 The increased CD64 expression during pregnancy in patients with multiple sclerosis is indicative of enhanced innate immune functions.
19330030 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17124586 Fcgamma receptor I Ab and Fcgamma receptor I play an important role in the regulation of alopecia areata (AA), are useful for a marker of the disease prognosis and are worth intense research for the reasonable and specific therapy of AA.
11802953 Observational study of gene-disease association. (HuGE Navigator)
9490697 IgG2 and IgG4 bind more poorly to enzymatically deglycosylated recombinant gp120 (rgp120) than to unchanged rgp120

AA Sequence

MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSY      1 - 70
RITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFMEGEPLALRCHAWKDKLVYNVLYYRN     71 - 140
GKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAGISQYTVKGLQLPTPVWFHVLFYLAVGIMFL    141 - 210
VNTVLWVTIRKELKRKKKWNLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT    211 - 280
//

Text Mined References (15)

PMID Year Title
21135020 2011 The monocyte transcriptome during pregnancy in multiple sclerosis: prominent expression of the Fc-receptor CD64.
19330030 2009 A multistage genome-wide association study in breast cancer identifies two new risk alleles at 1p11.2 and 14q24.1 (RAD51L1).
17124586 2007 Serum anti-Fcgamma receptor autoantibodies in patients with alopecia areata.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12766061 2003 Gene expression profile of the human trabecular meshwork: NEIBank sequence tag analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11802953 2001 [Study on mutations of beta chain of high-affinity IgE receptor gene in people of Han nationality of southern China].
9881690 1998 Molecular characterization of six variant Fcgamma receptor class I (CD64) transcripts.
9763663 1998 Localization of FCGR1 encoding Fcgamma receptor class I in primates: molecular evidence for two pericentric inversions during the evolution of human chromosome 1.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8697799 1996 The three genes of the human FCGR1 gene family encoding Fc gamma RI flank the centromere of chromosome 1 at 1p12 and 1q21.
1830050 1991 Gene organization of the human high affinity receptor for IgG, Fc gamma RI (CD64). Characterization and evidence for a second gene.
1430234 1992 Novel Fc gamma receptor I family gene products in human mononuclear cells.
1402657 1992 Definition of interferon gamma-response elements in a novel human Fc gamma receptor gene (Fc gamma RIb) and characterization of the gene structure.
1379234 1992 Three genes for the human high affinity Fc receptor for IgG (Fc gamma RI) encode four distinct transcription products.