Property Summary

NCBI Gene PubMed Count 119
PubMed Score 1006.30
PubTator Score 1075.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.500 9.5e-65

 CSPA Cell Line (2)

Gene RIF (91)

PMID Text
26527150 The three-dimensional structure of a human IgG1 Fc fragment bound to wild-type human Fc-gamma RI is reported
26406605 Early RA patients display increased membrane and soluble CD64 and an impaired FcgammaR function correlating with joint disease activity.
26322411 Monocyte HLA-DR and neutrophil CD64 expression in critically ill infants with sepsis are related to age and infection.
26153451 The results indicate that conformational plasticity, as well as the openness of the upper CH2 region, is critical for FcgammaR binding and therapeutic effector functions of IgG antibodies.
26147145 neutrophil CD64 expression tends to be low in the healthy state and increases in patients with advanced cancer even in the absence of active infection
26025597 GZMA, GBP5 and CD64 genes show promise as a rapid diagnostic markers separating tuberculosis from other pulmonary diseases.
25925696 hydrophobic pocket at the surface perfectly suited for residue Leu235 of Fc
25854904 CD64 index, CRP and sCD14-ST served as good parameters to determine possible infection in patients that needed intensive care after major procedures.
25802446 we address of monocytes functional status through assessment of the patterns of expression of Fcgamma receptors CD64, CD32, CD16 and CD180 receptor on monocytes from CLL patients and healthy individuals using specific mAbs and flow cytometry.
25566870 FcgammaRI levels were found to not be associated with vascular leakage in dengue patients.
25517313 Data suggest that the specific blocking of immunoglobulin G receptor CD64 by H22(scFv) could be used a possible anti-inflammatory mechanism for potentiating the effect of anti-tumor necrosis factor (TNF) antibodies.
25484053 Data indicate that monoclonal antibody Hu 15C1 simultaneously interacts with both Toll like receptor 4 (TLR4) and Fcgamma receptors (FcgammaRI or FcgammaRIIA) at the cell surface.
25484046 Data show that IgG4 is capable of transducing signal through FC gamma RI (FcgammaRI).
25345863 Data show that the recombinant Fc gamma receptors FcgammaRIa, FcgammaRIIa, FcgammaRIIb, FcgammaRIIIa(Phe158/Val158), and FcgammaRIIIb glycosylation is complex and varied between receptors.
25324452 diagnostic accuracy of CD64 index to predict sepsis in critically ill patients
25180450 high expression of CD64 is an indicator important in the diagnosis of infection and sepsis.
25033045 Neutrophil CD64 is a highly sensitive marker for suspected early-onset sepsis in preterm neonates.
24827394 Acute alcohol exposure decreased neutrophil CD64 expression in critically ill nontrauma patients.
24810583 Describe biosensing techniques to evaluate the glycosylation pattern of monoclonal antibodies using the extracellular domains of CD64a.
24788216 An elevated neutrophil CD64 index is associated with both mucosal inflammation and an increased risk for clinical relapse in pediatric Crohn disease.
24623459 CD64 is expressed on neutrophils and monocytes in periodic fever, aphthous stomatitis, pharyngitis, and cervical adenitis (PFAPA) syndrome during flares
24463977 CD64 expression on neutrophils increases significantly in neonates with sepsis and is a useful diagnostic marker for early diagnosis of neonatal infection.
24205913 FCGR1A (high-affinity IgG Fc receptor 1 (CD64)) was the only marker expressed at significantly higher levels in participants with active tuberculosis.
24046202 As a surveillance biomarker, neutrophil CD64 detected LOS/NEC 1.5 days before clinical presentation, but at the expense of performing 41% additional sepsis evaluations
23697368 Data indicate that upon sialylation, the affinities for Fcgamma receptors are reduced, whereas those for alternative cellular receptors, such as dendritic cell-specific intercellular adhesion molecule-3-grabbing nonintegrin (DC-SIGN)/CD23, are increased.
23452299 Neutrophil CD64 (nCD64) expression was higher in patients with severe sepsis/septic shock (81.2%) and sepsis(78.8%) as compared to those with traumatic brain injury (5.5%) or controls (0.9%, p < 0.0001).
23293080 FcgammaRI (CD64) promotes IgG-mediated inflammation, anaphylaxis, and antitumor immunotherapy.
23023090 Data indicate a tool for measuring antibodies triggering activation of FcgammaRIIIA, FcgammaRIIA or FcgammaRI receptors.
22967788 Screening identified 19 amino acid mutations contributing to the thermal stability and production rate of rhFcgammaRI
22759273 Combinatorial immunophenotypic analyses showed that loss of PTEN expression with concomitant IGFR-1 expression correlated with poor disease-free survival
22493081 observations suggest that serum amyloid P, at least in part, uses FcgammaRI and FcRgamma to inhibit fibrocyte differentiation
22420242 Neutrophil CD64 appears to be a better diagnostic test than traditional hematological assays.
22251373 Data indicate the simultaneous analysis of CD64 together with CD304 (Neuropilin-1) or the combination of CD11b and CD38 was suitable for the identification of rheumatoid arthritis (RA)patients with high current activity in synovitis.
22237765 Simultaneous quantitative analysis of CD64 and CD35 expression on neutrophils might be useful to distinguish between bacterial and viral infections in rheumatoid arthritis patients.
22003208 A phosphoserine-dependent tethering role for protein 4.1G in lipid rafts provides insight into the unique phosphoserine-based regulation of FcgammaRI receptor signaling.
21965667 a molecular mechanism for the high affinity IgG recognition by FcgammaRI
21832933 IgG2 and IgG4 bind more poorly to enzymatically deglycosylated recombinant gp120 (rgp120) than to unchanged rgp120
21438869 increased expression on polymorphonuclear neutrophils in patients with familial Mediterranean fever in Japan
21325219 This review implicates high-affinity FcgammaRI as a potential immune mediator with a key role in antigen presentation and antibody-based immunotherapy.
21243031 Expression of CD64 (FcgammaRI) in skin of patients with acute GVHD.
21239714 FcgammaR-mediated phagocytosis of neutrophils requires intracellular depletion of divalent calcium stores for the internalization phase.
21061041 Data show that IgG heavy chains and IgG receptors were detected in the intraocular epithelium and endothelium.
20840056 neutrophil expression has a good sensitivity and specificity in differentiating infection from disease flare in patients with inflammatory autoimmune diseases
20650300 elevated expression on CD1+ DC from allergic rhinitis patients
20418097 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20306688 Data show that neutrophil expression of CD64 is a useful diagnostic tool for early detection of neonatal sepsis.
20109752 Expression of TSLP receptor was upregulated on atopic DCs primed with H22-Fel d 1 through a pathway regulated by FcgammaRI-associated signaling components.
20080725 Aglycosylated immunoglobulin G can be engineered to display unique FcgammaR selectivity profiles that, in turn, mediate antibody dependent cell cytotoxicity.
20071662 HRG has the unique property of complexing with IgG and facilitating a proinflammatory innate immune response to promote the clearance of necrotic cells via FcgammaRI
19833736 Data show that LILRB4 is a potent inhibitor of monocyte activation via FcgammaRI.
19635920 Activation of monocytes via Fc gamma RI induces differentiation, imparting specific inflammatory functions of autoreactive T cells that may contribute to pathogenesis of immune complex-mediated tissue injury.
19250681 Structural characterization of a human Fc fragment engineered for extended serum half-life.
19144150 circulating monocytes activated by immune complexes and/or proinflammatory mediators upregulate surface expression of FcgammaRI/CD64 in systemic lupus erythematosus
19011162 expression of CD49d and CD64 on blood neutrophils is upregulated in plasma from patients with sepsis
18974296 Data suggest that flagellin-specific IgG/Fc gamma receptor I complex immune responses activate mast cells in the intestine and play important roles in the pathogenesis of intestinal immune inflammation.
18941257 Aspartic acid at position 265 of IgG is a residue critically implicated in triggering the Fc-associated effector functions of IgG, probably by defining a crucial three-dimensional structure of the Fc region.
18826388 Splenic macrophages that take up opsonized platelets via FcgammaRI are major APCs for cryptic GPIIb/IIIa peptides, and are central to the maintenance of anti-platelet autoantibody production in ITP patients
18798798 lower numbers of CD64-positive circulating DCs during gestation than in adults
18606652 These results provide a mechanism by which Fcgamma receptors can elevate circulating BLyS levels and promote autoantibody production in immune complex-mediated autoimmune diseases.
18604302 Data show that CD64 indexes for neutrophils and monocytes, and CD163 index for neutrophils can all be used for discrimination of SIRS and sepsis in critically ill neonates and children.
18321309 Observational study of gene-disease association. (HuGE Navigator)
18320015 Data show that in cardiac surgical patients the expression of activation marker FcgammaR1 (CD64) on monocytes is increased earlier in comparison with granulocytes in both "on-pump" and "off-pump" patients.
18279703 RAGE could also behave as a receptor for Mycobacterium tuberculosis
18207250 FcgammaRI predominantly resides in thin detergent-insoluble buoyant membranes, together with FcRgamma-chain, but independent of cross-linking ligand
18071883 Activation of mast cells through aggregation of Fc-gamma receptor I leads to degranulation, induction of prosurvival gene bfl-1, and promotion of cell survival.
18063701 the response to vascular injury provoked by human C-Reactive Protein in ovariectomized C-reactive protein transgenic mice depends on Fc gamma RI and probably requires its expression by F4/80+ cells
18023480 An alternatively spliced 4.1G product is shown to be associated with increased Fc gamma RI binding in yeast two-hybrid assays, and to be selectively enriched in most immune cells at the transcript level.
17827066 FcgammaRI is hyperexpressed in the intestinal mast cells of Crohn disease patients.
17764536 In platelets, GPVI-FcRgamma has evolved to transmit sustained signals in order to maintain spreading over several hours, as well as facilitating rapid activation through release of feedback agonists and integrin activation.
17621550 kinetics of neutrophil membrane CD64 expression were examined during a standardized inflammatory response, using a human endotoxemia model
17511516 finding documents the capacity of FcgammaRI to mediate potent antimalaria immunity
17124586 Fcgamma receptor I Ab and Fcgamma receptor I play an important role in the regulation of alopecia areata (AA), are useful for a marker of the disease prognosis and are worth intense research for the reasonable and specific therapy of AA.
17005690 findings showed that that both Fcgamma RIA and FcgammaRIIA mediated enhanced dengue virus immune complex infectivity but that FcgammaRIIA appeared to do so far more effectively
16603696 in human aortic endothelial cells, CRP upregulates monocyte-endothelial adhesion by activation of NF-kappaB through engaging the Fcgamma receptors CD32 and CD64
16140266 Thus, these results suggest that the lipid raft-associated 67LR plays an important role in mediating the FcepsilonRI-suppressive action of EGCG.
15883031 results imply a novel functional role of CD13 and Fc gamma receptors (CD32 and CD64)as members of a multimeric receptor complex
15878871 analysis of C-reactive protein binding to FcgammaRI, FcgammaRIIa, and C1q
15528366 Fc fragments of IgG from healthy donors or purified monoclonal anti-human Fc gamma receptor (FcgammaR) antibody strengthen the participation of FcgammaRI (CD64) in HIV-1 inhibition on monocyte-derived macrophages.
15251320 FcgammaRIIa polymorphism is not an important genetic risk factor for chronic rejection of kidney allografts.
15229321 periplakin (PPL) as a selective interacting protein for the intracellular tail of FcgammaRI but no other activatory FcRs
15087090 Observational study of gene-disease association. (HuGE Navigator)
14728877 The levels of peripheral blood neutrophil CD(64) may help us distinguish infection from disease activation in systemic lupus erythematosus (SLE).
12830330 Observational study of genotype prevalence. (HuGE Navigator)
12756162 specific sequences in the FcgammaRIIIA and FcgammaRI transmembrane domains govern their different interactions with the gamma chain in cell surface expression and phagocytosis
12581186 FcgammaRI plays a major role in anti-HPA-1a-mediated platelet phagocytosis by monocytes while FcgammaRIIa, is of little or minor importance only.
12377934 cross-linking FcgammaRI and -II but not FcgammaRIII activates transcription factor NF-kappaB
12217397 Activation of mast cells through the high affinity IgG receptor.
12200451 CY domain alters gamma-chain tyrosine-based signaling and phagocytosis
12130529 Distinct functions for STAT1 and PU.1 in transcriptional activation of Fc gamma receptor I promoter.
11714794 At least two alternate mechanisms of internalization of Fc gamma RI are influenced by the presence or absence of ligand and demonstrate the receptor's physiologic potential to transport a large antigenic load into antigen presenting cells for processing.
9490697 IgG2 and IgG4 bind more poorly to enzymatically deglycosylated recombinant gp120 (rgp120) than to unchanged rgp120

AA Sequence

MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSY      1 - 70
RITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFTEGEPLALRCHAWKDKLVYNVLYYRN     71 - 140
GKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAGISVTVKELFPAPVLNASVTSPLLEGNLVTL    141 - 210
SCETKLLLQRPGLQLYFSFYMGSKTLRGRNTSSEYQILTARREDSGLYWCEAATEDGNVLKRSPELELQV    211 - 280
LGLQLPTPVWFHVLFYLAVGIMFLVNTVLWVTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEE    281 - 350
LKCQEQKEEQLQEGVHRKEPQGAT                                                  351 - 374
//

Text Mined References (125)

PMID Year Title
26527150 2015 Structural insights into the interaction of human IgG1 with Fc?RI: no direct role of glycans in binding.
26406605 2015 Elevated Membrane and Soluble CD64: A Novel Marker Reflecting Altered Fc?R Function and Disease in Early Rheumatoid Arthritis That Can Be Regulated by Anti-Rheumatic Treatment.
26322411 2015 Monocyte HLA-DR expression and neutrophil CD64 expression as biomarkers of infection in critically ill neonates and infants.
26153451 2015 Structural consequences of aglycosylated IgG Fc variants evolved for Fc?RI binding.
26147145 2015 Neutrophil CD64 expression: a reliable diagnostic marker of infection in advanced cancer patients?
26025597 2015 A real-time PCR signature to discriminate between tuberculosis and other pulmonary diseases.
25925696 2015 Structural basis for binding of human IgG1 to its high-affinity human receptor Fc?RI.
25854904 2015 Diagnostic and prognostic value of sCD14-ST--presepsin for patients admitted to hospital intensive care unit (ICU).
25802446 2015 Aberrant expression of Fc?-receptors and Toll like receptor CD180 on monocytes from patients with chronic lymphocytic leukaemia.
25566870 2015 The high-affinity human IgG receptor Fc gamma receptor I (Fc?RI) is not associated with vascular leakage of dengue.
25517313 2014 Recombinant H22(scFv) blocks CD64 and prevents the capture of anti-TNF monoclonal antibody. A potential strategy to enhance anti-TNF therapy.
25484053 2014 Maximizing the potency of an anti-TLR4 monoclonal antibody by exploiting proximity to Fc? receptors.
25484046 2014 IgG4 can induce an M2-like phenotype in human monocyte-derived macrophages through Fc?RI.
25345863 2014 Fc gamma receptor glycosylation modulates the binding of IgG glycoforms: a requirement for stable antibody interactions.
25324452 2015 Expression of CD64 on neutrophils (CD64 index): diagnostic accuracy of CD64 index to predict sepsis in critically ill patients.
25180450 2014 Neutrophil CD64 expression as an important diagnostic marker of infection and sepsis in hospital patients.
25033045 2014 Diagnostic utility of neutrophil CD64 as a marker for early-onset sepsis in preterm neonates.
24827394 2014 Acute alcohol exposure has an independent impact on C-reactive protein levels, neutrophil CD64 expression, and subsets of circulating white blood cells differentiated by flow cytometry in nontrauma patients.
24810583 2014 Towards the development of a surface plasmon resonance assay to evaluate the glycosylation pattern of monoclonal antibodies using the extracellular domains of CD16a and CD64.
24788216 2014 Utility of neutrophil Fc? receptor I (CD64) index as a biomarker for mucosal inflammation in pediatric Crohn's disease.
24623459 2014 Markedly elevated CD64 expressions on neutrophils and monocytes are useful for diagnosis of periodic fever, aphthous stomatitis, pharyngitis, and cervical adenitis (PFAPA) syndrome during flares.
24463977 2014 Neutrophil CD64 as a diagnostic marker of sepsis in neonates.
24205913 2014 Differential gene expression of activating Fc? receptor classifies active tuberculosis regardless of human immunodeficiency virus status or ethnicity.
24046202 2013 Neutrophil CD64 for daily surveillance of systemic infection and necrotizing enterocolitis in preterm infants.
23697368 2013 General mechanism for modulating immunoglobulin effector function.
23452299 2013 CD64-Neutrophil expression and stress metabolic patterns in early sepsis and severe traumatic brain injury in children.
23293080 2013 The high-affinity human IgG receptor Fc?RI (CD64) promotes IgG-mediated inflammation, anaphylaxis, and antitumor immunotherapy.
23023090 2013 A novel assay for detecting virus-specific antibodies triggering activation of Fc? receptors.
22967788 2012 Engineering of recombinant human Fc? receptor I by directed evolution.
22759273 2012 Insulin growth factor receptor-1 expression and loss of PTEN protein predict early recurrence in triple-negative breast cancer.
22493081 2012 Fc?RI mediates serum amyloid P inhibition of fibrocyte differentiation.
22420242 2011 Neutrophil CD64 as a sepsis biomarker.
22251373 2012 Identification and evaluation of novel synovial tissue biomarkers in rheumatoid arthritis by laser scanning cytometry.
22237765 2012 Simultaneous quantitative analysis of the expression of CD64 and CD35 on neutrophils as markers to differentiate between bacterial and viral infections in patients with rheumatoid arthritis.
22003208 2012 Serine phosphorylation of Fc?RI cytoplasmic domain directs lipid raft localization and interaction with protein 4.1G.
21965667 2011 Crystal structure of Fc? receptor I and its implication in high affinity ?-immunoglobulin binding.
21438869 2011 Expression of CD64 on polymorphonuclear neutrophils in patients with familial Mediterranean fever.
21325219 2011 Functional characteristics of the high affinity IgG receptor, Fc?RI.
21243031 2011 Expression of CD64 (Fc?RI) in skin of patients with acute GVHD.
21239714 2011 An essential role of STIM1, Orai1, and S100A8-A9 proteins for Ca2+ signaling and Fc?R-mediated phagosomal oxidative activity.
21061041 2011 Expression and distribution of immunoglobulin G and its receptors in an immune privileged site: the eye.
20840056 2010 Neutrophil CD64 expression in inflammatory autoimmune diseases: its value in distinguishing infection from disease flare.
20650300 2010 Fc?RI levels and frequencies of peripheral blood dendritic cell populations in allergic rhinitis.
20418097 2010 Correlation of FCGR3A and EGFR germline polymorphisms with the efficacy of cetuximab in KRAS wild-type metastatic colorectal cancer.
20306688 2008 CD64 cell surface expression on neutrophils for diagnosis of neonatal sepsis.
20109752 2010 Targeting allergen to FcgammaRI reveals a novel T(H)2 regulatory pathway linked to thymic stromal lymphopoietin receptor.
20080725 2010 Aglycosylated IgG variants expressed in bacteria that selectively bind FcgammaRI potentiate tumor cell killing by monocyte-dendritic cells.
20071662 2010 Histidine-rich glycoprotein is a novel plasma pattern recognition molecule that recruits IgG to facilitate necrotic cell clearance via FcgammaRI on phagocytes.
19833736 2009 Leukocyte Ig-like receptor B4 (LILRB4) is a potent inhibitor of FcgammaRI-mediated monocyte activation via dephosphorylation of multiple kinases.
19635920 2009 Activation of Fc gamma RI on monocytes triggers differentiation into immature dendritic cells that induce autoreactive T cell responses.
19250681 2009 Structural characterization of a human Fc fragment engineered for extended serum half-life.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19144150 2009 Increased expression of FcgammaRI/CD64 on circulating monocytes parallels ongoing inflammation and nephritis in lupus.
19011162 2009 Plasma from patients with sepsis up-regulates the expression of CD49d and CD64 on blood neutrophils.
18974296 2008 Fc gamma receptor signaling in mast cells links microbial stimulation to mucosal immune inflammation in the intestine.
18941257 2008 Crucial role of aspartic acid at position 265 in the CH2 domain for murine IgG2a and IgG2b Fc-associated effector functions.
18826388 2009 Splenic macrophages maintain the anti-platelet autoimmune response via uptake of opsonized platelets in patients with immune thrombocytopenic purpura.
18798798 2009 Phenotypic analysis of circulating dendritic cells during the second half of human gestation.
18606652 2008 Immune opsonins modulate BLyS/BAFF release in a receptor-specific fashion.
18604302 2008 Neutrophil and monocyte CD64 and CD163 expression in critically ill neonates and children with sepsis: comparison of fluorescence intensities and calculated indexes.
18322202 2008 Filamin A stabilizes Fc gamma RI surface expression and prevents its lysosomal routing.
18321309 2008 Association of interleukin-1 receptor antagonist +2018 gene polymorphism with Japanese chronic periodontitis patients using a novel genotyping method.
18320015 2008 Early expression of FcgammaRI (CD64) on monocytes of cardiac surgical patients and higher density of monocyte anti-inflammatory scavenger CD163 receptor in "on-pump" patients.
18279703 2008 Expression of CD64, CD206, and RAGE in adherent cells of diabetic patients infected with Mycobacterium tuberculosis.
18207250 2008 FcgammaRI (CD64) resides constitutively in lipid rafts.
18071883 2008 Fc gamma RI-mediated activation of human mast cells promotes survival and induction of the pro-survival gene Bfl-1.
18063701 2008 Exaggerated neointima formation in human C-reactive protein transgenic mice is IgG Fc receptor type I (Fc gamma RI)-dependent.
18023480 2008 Protein 4.1G binds to a unique motif within the Fc gamma RI cytoplasmic tail.
17827066 2007 Hyperexpression of FcgammaRI and Toll-like receptor 4 in the intestinal mast cells of Crohn's disease patients.
17764536 2007 Collagen promotes sustained glycoprotein VI signaling in platelets and cell lines.
17621550 2007 Hematological indices, inflammatory markers and neutrophil CD64 expression: comparative trends during experimental human endotoxemia.
17511516 2007 The importance of human FcgammaRI in mediating protection to malaria.
17124586 2007 Serum anti-Fcgamma receptor autoantibodies in patients with alopecia areata.
17005690 2006 Differential enhancement of dengue virus immune complex infectivity mediated by signaling-competent and signaling-incompetent human Fcgamma RIA (CD64) or FcgammaRIIA (CD32).
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16603696 2006 CRP promotes monocyte-endothelial cell adhesion via Fcgamma receptors in human aortic endothelial cells under static and shear flow conditions.
16140266 2005 A lipid raft-associated 67kDa laminin receptor mediates suppressive effect of epigallocatechin-3-O-gallate on FcepsilonRI expression.
15883031 2005 Functional co-localization of monocytic aminopeptidase N/CD13 with the Fc gamma receptors CD32 and CD64.
15878871 2005 Analysis of binding sites in human C-reactive protein for Fc{gamma}RI, Fc{gamma}RIIA, and C1q by site-directed mutagenesis.
15528366 2004 Involvement of Fc gamma RI (CD64) in the mechanism of HIV-1 inhibition by polyclonal IgG purified from infected patients in cultured monocyte-derived macrophages.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
15251320 2004 The FcgammaRIIa polymorphism in patients with chronic kidney graft rejection.
15229321 2004 Direct interaction between FcgammaRI (CD64) and periplakin controls receptor endocytosis and ligand binding capacity.
15087090 Genetic variants of FcepsilonRIbeta and Il-4 and atopy in a Polish population.
14728877 2003 [The expression of peripheral blood neutrophil CD64 in systemic lupus erythematosus with infection or disease activation].
12830330 2003 Evidence for non-random distribution of Fcgamma receptor genotype combinations.
12756162 2003 Fcgamma receptor transmembrane domains: role in cell surface expression, gamma chain interaction, and phagocytosis.
12581186 2003 Anti-HPA-1a-mediated platelet phagocytosis by monocytes in vitro and its inhibition by Fc gamma receptor (FcgammaR) reactive reagents.
12524384 2003 IgA Fc receptors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471137 2002 C-reactive protein mediates protection from lipopolysaccharide through interactions with Fc gamma R.
12377934 2002 FcgammaR cross-linking mediates NF-kappaB activation, reduced antigen presentation capacity, and decreased IL-12 production in monocytes without modulation of myeloid dendritic cell development.
12217397 2002 Activation of human mast cells through the high affinity IgG receptor.
12200451 2002 The CY domain of the Fcgamma RIa alpha-chain (CD64) alters gamma-chain tyrosine-based signaling and phagocytosis.
12130529 2002 Distinct functions for signal transducer and activator of transcription 1 and PU.1 in transcriptional activation of Fc gamma receptor I promoter.
12006325 2002 Neutrophil CD64 expression: distinguishing acute inflammatory autoimmune disease from systemic infections.
11708889 2001 Phagocytic signaling strategies: Fc(gamma)receptor-mediated phagocytosis as a model system.
11359830 2001 Serum amyloid P component binds to Fc gamma receptors and opsonizes particles for phagocytosis.
11141335 2001 Fc gamma receptors differ in their structural requirements for interaction with the tyrosine kinase Syk in the initial steps of signaling for phagocytosis.
10933786 2000 Crystal structure and immunoglobulin G binding properties of the human major histocompatibility complex-related Fc receptor(,).
10879688 2000 Human MO subsets as defined by expression of CD64 and CD16 differ in phagocytic activity and generation of oxygen intermediates.
10781611 2000 The adapter protein LAT enhances fcgamma receptor-mediated signal transduction in myeloid cells.
10514529 1999 The cytoplasmic domain of human FcgammaRIa alters the functional properties of the FcgammaRI.gamma-chain receptor complex.
10421785 1999 Histidine-rich glycoprotein regulates the binding of monomeric IgG and immune complexes to monocytes.
10397749 1999 The FcgammaRIa (CD64) ligand binding chain triggers major histocompatibility complex class II antigen presentation independently of its associated FcR gamma-chain.
9881690 1998 Molecular characterization of six variant Fcgamma receptor class I (CD64) transcripts.
9842885 1998 The MHC class I binding proteins LIR-1 and LIR-2 inhibit Fc receptor-mediated signaling in monocytes.
9820532 1998 Differential interaction of Crkl with Cbl or C3G, Hef-1, and gamma subunit immunoreceptor tyrosine-based activation motif in signaling of myeloid high affinity Fc receptor for IgG (Fc gamma RI).
9763663 1998 Localization of FCGR1 encoding Fcgamma receptor class I in primates: molecular evidence for two pericentric inversions during the evolution of human chromosome 1.
8697799 1996 The three genes of the human FCGR1 gene family encoding Fc gamma RI flank the centromere of chromosome 1 at 1p12 and 1q21.
8611682 1996 FcR gamma-chain is essential for both surface expression and function of human Fc gamma RI (CD64) in vivo.
8530370 1995 Functional association between the human myeloid immunoglobulin A Fc receptor (CD89) and FcR gamma chain. Molecular basis for CD89/FcR gamma chain association.
8270248 1994 Human high-affinity Fc gamma RI (CD64) gene mapped to chromosome 1q21.2-q21.3 by fluorescence in situ hybridization.
8064233 1994 Physical and functional association of the high affinity immunoglobulin G receptor (Fc gamma RI) with the kinases Hck and Lyn.
7687898 1993 Involvement of the high-affinity receptor for IgG (Fc gamma RI; CD64) in enhanced tumor cell cytotoxicity of neutrophils during granulocyte colony-stimulating factor therapy.
7516890 1994 The high affinity Fc gamma receptor (CD64) induces phagocytosis in the absence of its cytoplasmic domain: the gamma subunit of Fc gamma RIIIA imparts phagocytic function to Fc gamma RI.
2974947 1988 Nucleotide sequence of three cDNAs for the human high affinity Fc receptor (FcRI).
2911749 1989 Isolation and expression of functional high-affinity Fc receptor complementary DNAs.
2852656 1988 Induction of Fc (IgG) receptor(s) by simian cytomegaloviruses in human embryonic lung fibroblasts.
1837149 1991 Characterization of the promoter of the human gene encoding the high-affinity IgG receptor: transcriptional induction by gamma-interferon is mediated through common DNA response elements.
1830050 1991 Gene organization of the human high affinity receptor for IgG, Fc gamma RI (CD64). Characterization and evidence for a second gene.
1430234 1992 Novel Fc gamma receptor I family gene products in human mononuclear cells.
1402657 1992 Definition of interferon gamma-response elements in a novel human Fc gamma receptor gene (Fc gamma RIb) and characterization of the gene structure.
1379234 1992 Three genes for the human high affinity Fc receptor for IgG (Fc gamma RI) encode four distinct transcription products.