Property Summary

NCBI Gene PubMed Count 127
PubMed Score 208.44
PubTator Score 640.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Atopic dermatitis -1.300 1.5e-02
acute myeloid leukemia -2.600 3.7e-02
Astrocytoma, Pilocytic 1.100 4.1e-03
Barrett's esophagus -1.700 3.6e-02
cutaneous lupus erythematosus -2.900 1.0e-03
esophageal adenocarcinoma -1.800 2.5e-02
head and neck cancer -3.300 1.3e-06
head and neck cancer and chronic obstruc... -1.600 8.8e-04
interstitial cystitis -1.100 1.4e-02
intraductal papillary-mucinous carcinoma... -1.200 2.3e-02
invasive ductal carcinoma -2.200 5.0e-03
lung cancer -1.800 9.1e-03
mucosa-associated lymphoid tissue lympho... -1.114 3.6e-02
non-small cell lung cancer -2.800 7.8e-24
osteosarcoma -3.502 2.4e-04
ovarian cancer -1.500 1.2e-05
pancreatic cancer -1.600 5.7e-03
pancreatic carcinoma -1.600 5.7e-03
psoriasis -1.100 2.4e-04
tuberculosis 1.700 7.4e-03

PDB (10)

Gene RIF (112)

AA Sequence

MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSL      1 - 70
SEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDV     71 - 140
YKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQFFIPL    141 - 210
LVVILFAVDTGLFISTQQQVTFLLKIKRTRKGFRLLNPHPKPNPKNN                           211 - 257
//

Text Mined References (128)

PMID Year Title