Property Summary

NCBI Gene PubMed Count 125
PubMed Score 208.20
PubTator Score 640.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
pancreatic cancer -1.600 5.7e-03
Barrett's esophagus -1.700 3.6e-02
esophageal adenocarcinoma -1.800 2.5e-02
psoriasis -1.700 3.5e-04
cutaneous lupus erythematosus -2.900 1.0e-03
osteosarcoma -3.502 2.4e-04
Atopic dermatitis -1.300 1.5e-02
tuberculosis and treatment for 3 months 2.600 8.4e-06
non-small cell lung cancer -2.800 7.8e-24
intraductal papillary-mucinous carcinoma... -1.200 2.3e-02
lung cancer -3.000 2.8e-04
interstitial cystitis -1.100 1.4e-02
pilocytic astrocytoma 1.100 4.8e-03
pancreatic carcinoma -1.600 5.7e-03
mucosa-associated lymphoid tissue lympho... -1.114 3.6e-02
invasive ductal carcinoma -2.200 5.0e-03
acute myeloid leukemia -2.600 3.7e-02
ovarian cancer -1.500 1.2e-05
head and neck cancer -3.300 1.3e-06
head and neck cancer and chronic obstruc... -1.600 8.8e-04

 GWAS Trait (1)

Gene RIF (110)

PMID Text
26774660 IgG2 and IgG3 are involved in recruiting CD32 to inhibit activation of FcepsilonRI in human basophils.
26707911 F-AFE containing anti-allergic phytochemicals, including arctigenin, inhibited the activation of the FceRI receptor induced by the antigenIgE complex
26626992 Asthmatics with reduced lung function had a higher frequency of Lin(-) CD34(hi) CD117(int/hi) Fc epsilon RI(+) blood mast cell progenitors than asthmatics with normal lung function.
26136426 Tetraspanin CD151 Is a Negative Regulator of FcepsilonRI-Mediated Mast Cell Activation
25923080 SNPs of FcepsilonR1alpha promoter region may be used as disease markers for IgE-mediated allergic inflammation caused by Dermatophagoides pteronyssinus.
25713122 FcepsilonRI alpha-chain is an activating platelet endothelium aggregation receptor 1 (PEAR1) ligand.
25412950 These data suggest that rs2298805 might be associated with risk for Chronic urticaria and the therapeutic efficacy of nonsedating H1-antihistamines in Chinese patients
24610015 Data indicate that antigen (Ag) targeting to FcepsilonRI inhibits the development of Ag-specific T cell immunity and induces T cell tolerance.
24569373 FCER1A expressing dendritic cells and monocytes but not basophils, significantly contribute to serum hIgE clearance.
24361879 Overexpression of miR-142-3p enhances FcepsilonRI-mediated degranulation.
24354852 FCER2 polymorphism rs3760687 affects moderately elevated total serum IgE levels, especially in the absence of homozygosity for the risk allele of FCER1A SNP rs2427837.
23980848 elevated levels of surface-bound proteins on cord blood basophils is associated with maternal allergy
23725541 Genetic polymorphism is associated with IgE levels in asthmatics in Germany
23621092 We assayed the genotype and allele frequencies of rs2298804 (251 A>G) in the FCER1A gene, in patients with Systemic Lupus Erythematosus in a Chinese Han population and found a significant difference for both the AG genotype and the G allele
22800345 no association between SNP in the FCER1A gene region and serum total IgE level in Chinese allergic rhinitis patients
22384272 Expression of high-affinity IgE receptor on human peripheral blood dendritic cells in children
22222815 genetic polymorphisms in the promoter region is associated with atopic dermatitis in a Han Chinese population
22173243 Mutation in IgE receptor is associated with mast-cell leukemia.
21958156 increased FcepsilonRI expression on alveolar mast cells is a novel disease-specific feature of allergic asthma.
21903095 Data show that the developed method allows for comparative analysis of sFcepsilonRI levels in health and disease.
21738338 There were no significant relationships between FcepsilonRI and atopic dermatitis, although there were trends towards an association between the 66T>C (rs2251746) polymorphism and total serum IgE levels.
21725845 Linkage disequilibrium and the distribution of haplotypes for two identified human FCER1A 3'-UTR polymorphisms and several previously reported 5'-flanking region and 5'-UTR variants in Japanese and Poles, is described.
21622859 FcepsilonRI transgene on dendritic cells drives the cascade of pathogenic reactions linking the initial allergen capture by IgE with subsequent T helper (Th)2-dominated T cell responses and the development of late-phase allergic tissue inflammation.
21516097 The crystal structure of IgE bound to FcepsilonRI is determined.
21216468 Data indicate that although results rather show the lack of an association between FCER1A rs41264475 mutation and atopic dermatitis, they suggest that its minor allele can predispose to the concomitant asthma in AD patients.
21209833 SNPs in the FCER1A gene region show no association with allergic rhinitis in a Han Chinese population
20691829 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20664273 Secretagogue stimulation results in an increase in the immature p46 form of FcepsilonRIalpha due to reversal of degradative pathways rather than increased synthesis of FcepsilonRIalpha.
20603037 Observational study of gene-disease association. (HuGE Navigator)
20523060 Glucose can augment Fc epsilon RI-mediated mast cell activation, particularly the degranulation response and LTC(4) secretion after prolonged culture of mast cells with high-glucose medium.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20410486 counterregulation of FcepsilonRI and TLR-7 pathways exists in Plasmacytoid dendritic cells
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20163202 FcRIalpha gene variants are involved in the pathogenesis of IBD.
20163202 Observational study of gene-disease association. (HuGE Navigator)
20141544 Data show that atopic dermatitis patients with the FCER1A -315CT/TT genotype tended to have higher total serum IgE levels.
20126404 Data suggest a contribution of Fc epsilonRI alpha and gamma chains either to immunosurveillance or pathophysiology of the intestinal epithelium.
20117843 SP downregulated expression of FcepsilonRI in a concentration dependent manner; the effect was mediated by the neurokinin-1 receptor and resulted in reduced mast cell activation.
20028371 FCER1A variants by themselves and in combination influence IgE levels and act synergistically to influence eczema risk.
20028371 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19748979 Reconstitution of the immunoglobulin (Ig)E effect in the humanized Fc epsilon type I high affinity receptor alpha chain knockin mouse represents the first demonstration of human IgE antitumor adjuvanticity.
19697153 The ability of four synthetic and sequence-specific RNA interfering antisense oligodeoxynucleotides (AS-ODNs) to reduce the expression of FcepsilonRIalpha gene in granulocytes of allergy sufferers in vitro, was investigated.
19685047 FcepsilonRIalpha gene -18483A>C polymorphism affects transcriptional activity through YY1 binding.
19555572 Observational study of gene-disease association. (HuGE Navigator)
19514647 This observation suggests a functional relantionship of FcepsilonRI in the regulation of autoimmune response observed in Wegener's granulomatosis.
19514647 Observational study of gene-disease association. (HuGE Navigator)
19494509 The differential phosphorylation profiles of protein tyrosine residues in the resulting mast cells with or without FcepsilonRI aggregation were examined.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19385959 Expression of FcepsilonRI was significantly elevated on respiratory tract dendritic cells (RTDC) from atopic as compared to nonatopic patients.
19372141 Observational study of gene-disease association. (HuGE Navigator)
19359220 Results show that neutrophil FcepsilonRI expression is not regulated by serum IgE.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19245427 Common variants in FCER1A strongly influence basal IgE production independently from environmental stimuli.
19245427 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19164348 mast cells are able to store TSLP intracellularly and to produce TSLP following aggregation of FcepsilonRI in the presence of IL-4
19150851 progressive immobilization of Fc epsilon RI during aggregation was sensitive to syk or actin polymerization inhibition. Therefore, desensitization is also not dependent on receptor immobilization.
19141351 IgG autoantibodies with specificity for the FcepsilonRIalpha detected in 30% of patients with chronic urticaria; also described in patients with asthma
19082920 positive and negative regulators of FcepsilonRI have roles in mast cell activation [review]
18846228 Functional variants in the gene were strongly associated with total IgE levels in all cohorts.
18846228 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18726713 genetic polymorphismn, mutational screening and asthma association studies; review
18680511 polymorphisms genotyped in total of 88 Caucasians of the Polish origin were shown to be rare, with minor allele frequencies of 0.023 (-778C) and 0.017 (-673A
18595682 The FCER1G-237A>G and FCERIA-344C>T polymorphisms may contribute to the development of AIA in a Korean population.
18523286 A -315 single nucleotide polymorphism (SNP) significantly affects IgE receptor type I (FcERI) alpha-chain promoter activity and expression level of Fc epsilon RI on basophils by binding different transcription factors to the SNP site.
18394141 study investigated allelic frequencies, haplotypes and genetic linkage measures of the novel Ex1A polymorphisms in Japanese and compared them with those recalculated in Polish subjects
18382690 enhanced Fc epsilonRI expression in human neutrophils from allergic asthmatics during the pollen season can make them more susceptible to the biological effects of IgE
18356810 IgG autoantibodies to IgE or its receptor, Fc epsilonRIalpha, have been detected in chronic idiopathic urticaria (CIU) patients. CIU patients' basophils display distinct altered Fc epsilonRIalpha-mediated degranulation.
18321309 Observational study of gene-disease association. (HuGE Navigator)
18187193 Canine C epsilon3 is the only domain essential for binding to canine or human Fc epsilon RI alpha, species specific residues in canine Cepsilon2 and C epsilon4 inhibit dissociation of the ligand from the receptor.
18179824 These findings show that the extracellular domain of the type I transmembrane protein Fc epsilon RI alpha plays a role in Fc epsilon RI intracellular processing and expression at the cell surface.
18036650 Siglec-8 ligation was shown to inhibit beta-hexosaminidase release and Ca++ flux triggered through FcepsilonRI in RBL-2H3 cells transfected with full-length human Siglec-8.
17993265 Whereas FcvarepsilonRI required Lyn and Syk for NTAL phosphorylation, Kit appeared to directly phosphorylate NTAL
17965580 Within regulatory elements of FCER1A some common single nucleotide polymorphisms have functional associations which do not confer susceptibility to allergic diseases, but rather modulate serum concentrations of immunoglobulin E (IgE). [Review]
17883736 A conservative protein sequence of the high-affinity IgE receptor subunit a, despite its variations in non-coding flanking regions, suggests functional importance of the receptor in the development of adaptive immunity.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17686114 In caucasian, allergic patients, FCER1A and FCER1B polymorphisms showed an additive association with total serum IgE levels.
17541278 Using an anti-FcepsilonRI alpha-chain mAb, it was shown that IgE- & high-affinity receptor for IgE (FcepsilonRI)-dependent stimuli can upregulate basophil CD69 expression.
17521040 results replicate finding of higher -344CC genotype frequency in asthmatic patients with lower serum IgE levels; association suggests functional role of -344TT genotype, leading to elevated IgE levels in allergic patients by means of an unknown mechanism
17430357 Observational study of gene-disease association. (HuGE Navigator)
17267694 the plasma membrane distributions of IGE receptor and its cross-talk with formyl peptide receptor
17165285 Genetic variability of FCER1A exon 2A was evaluated and the -12663 A>G FCER1A polymorphism frequency was determined in a representative sample of whites.
17125826 Observational study of gene-disease association. (HuGE Navigator)
16709862 The stalk region of the Fc epsilon receptor I alpha-chain is the portion of the molecule regulating the stability of FceRI on the cell surface.
16581830 This and other evidence discussed in this review provide an emerging view of FcepsilonR/IgE network as a critical modulator of ASM cell function in allergic asthma.
16563391 Soluble FcepsilonRIalpha is shown to display characteristic properties of a catalyst for the folding of Cepsilon3, with the rate of Cepsilon3 folding being dependent on the concentration of the receptor.
16459334 IgE receptor alpha-chain transport is controlled by a multicomponent intracellular retention signal
16339523 microarray data identify Lyn as a negative regulator in Ag-stimulated bone marrow-derived mast cells of the expression of genes linked to FcepsilonRI signaling and also to the response pathways that lead to allergy and asthma
16237063 TLR9- and FcepsilonRI-mediated responses oppose one another in plasmacytoid dendritic cells by down-regulating receptor expression.
16081836 Cross-linking of the high affinity IgE receptor (Fc epsilon RI) induces mobilization of free calcium in airway smooth muscle cells, one of the critical signals to trigger smooth muscle contraction.
15743766 conformational change in IgE is required to allow both Cepsilon3 domains to bind to FcepsilonRI
15696081 Amphiregulin was secreted by human mast cells after aggregation of FcepsilonRI.
15562891 Observational study of gene-disease association. (HuGE Navigator)
15373772 FcepsilonRI+ on dendretic cells is finely modified by the TGF-beta1 concentration in the microenvironment and could be of primary relevance in the context of atopic diseases.
15217825 a combination of FcepsilonRI and Kit-mediated signals and transcriptional processes were required for optimal physiologic responses of human mast cells to antigen
15140034 Observational study of gene-disease association. (HuGE Navigator)
14746805 Results indicate that interleukin-4, together with recombinant human stem cell factor, can induce T cell maturation from cord blood progenitor cells, and that IL-4 increased the expression of FcepsilonRI on fetal liver mast cells.
14655898 Observational study of gene-disease association. (HuGE Navigator)
13129935 Fc epsilon RI-mediated calcium flux (dependent on PLC gamma 1) leads to degranulation of mast cells independent of PI 3-kinase
12902495 Observational study of gene-disease association. (HuGE Navigator)
12902495 T/C polymorphism in Fc epsilon RI alpha-chain promoter at nucleotide position -66 is associated with allergic diseases in a Japanese population.
12897750 In clinically uninvolved skin, Langerhans' cell-surface Fc epsilon RI expression is not only linked to atopic dermatitis but is also generally associated with allergic disease.
12855579 mast cells modulate the immune system following TLR4-mediated activation and FcepsilonRI aggregation
12270716 Efficient folding of the FcepsilonRI alpha-chain membrane-proximal domain D2 depends on the presence of the N-terminal domain D1.
12217383 Transcriptional regulation of the high affinity IgE receptor alpha-chain gene.
12200378 Regulation of FcepsilonRI-mediated degranulation by an adaptor protein 3BP2 in rat basophilic leukemia RBL-2H3 cells.
12070183 homozygosity for the C allele of FcepsilonRI alpha chain variant is associated with lower IgE levels
11776381 Observational study of gene-disease association. (HuGE Navigator)
11531339 x ray crystallography of multiple crystal forms

AA Sequence

MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSL      1 - 70
SEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDV     71 - 140
YKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQFFIPL    141 - 210
LVVILFAVDTGLFISTQQQVTFLLKIKRTRKGFRLLNPHPKPNPKNN                           211 - 257
//

Text Mined References (126)

PMID Year Title
26774660 2016 Parameters determining the efficacy of CD32 to inhibit activation of Fc?RI in human basophils.
26707911 2016 Inhibitory effect of fermented Arctium lappa fruit extract on the IgE-mediated allergic response in RBL?2H3 cells.
26626992 2016 Lin- CD34hi CD117int/hi Fc?RI+ cells in human blood constitute a rare population of mast cell progenitors.
26136426 2015 Tetraspanin CD151 Is a Negative Regulator of Fc?RI-Mediated Mast Cell Activation.
25923080 2015 An Exploratory Pilot Study of Genetic Marker for IgE-Mediated Allergic Diseases with Expressions of Fc?R1? and C?.
25713122 2015 A Human Platelet Receptor Protein Microarray Identifies the High Affinity Immunoglobulin E Receptor Subunit ? (Fc?R1?) as an Activating Platelet Endothelium Aggregation Receptor 1 (PEAR1) Ligand.
25412950 2015 Association of FCER1A genetic polymorphisms with risk for chronic spontaneous urticaria and efficacy of nonsedating H1-antihistamines in Chinese patients.
24610015 2014 Antigen-conjugated human IgE induces antigen-specific T cell tolerance in a humanized mouse model.
24569373 2014 Serum IgE clearance is facilitated by human Fc?RI internalization.
24361879 2014 miR-142-3p enhances Fc?RI-mediated degranulation in mast cells.
24354852 2014 A role of FCER1A and FCER2 polymorphisms in IgE regulation.
23980848 2013 Maternal allergy is associated with surface-bound IgE on cord blood basophils.
23725541 2013 Different FCER1A polymorphisms influence IgE levels in asthmatics and non-asthmatics.
23621092 2013 Sex-specific differences in the relationship between the single-nucleotide polymorphism rs2298804 of FCER1A and the susceptibility to systemic lupus erythematosus in a Chinese Han population.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22939635 2012 Genome-wide association and population genetic analysis of C-reactive protein in African American and Hispanic American women.
22800345 2012 [Association analysis between single-nucleotide polymorphisms in the FCER1A gene and serum total IgE level in patients with allergic rhinitis].
22384272 2012 Expression of high-affinity IgE receptor on human peripheral blood dendritic cells in children.
22222815 2012 Association of polymorphisms in the promoter region of FCER1A gene with atopic dermatitis, chronic uticaria, asthma, and serum immunoglobulin E levels in a Han Chinese population.
22173243 2012 Mast-cell leukemia exome sequencing reveals a mutation in the IgE mast-cell receptor ? chain and KIT V654A.
22075330 2012 A genome-wide association study of plasma total IgE concentrations in the Framingham Heart Study.
21958156 2011 Alveolar mast cells shift to an Fc?RI-expressing phenotype in mild atopic asthma: a novel feature in allergic asthma pathology.
21903095 2011 Development and validation of a standardized ELISA for the detection of soluble Fc-epsilon-RI in human serum.
21738338 2011 FC?RI gene promoter polymorphisms and total IgE levels in susceptibility to atopic dermatitis in Korea.
21725845 2012 A comparative search for human Fc?RI? gene (FCER1A) 3'-UTR polymorphisms in Japanese and Polish populations.
21622859 2011 High-affinity IgE receptors on dendritic cells exacerbate Th2-dependent inflammation.
21516097 2011 Conformational changes in IgE contribute to its uniquely slow dissociation rate from receptor Fc?RI.
21216468 2011 Naturally occurring FCER1A N222K mutation - its ethnicity-dependent distribution and a role in atopic dermatitis.
21209833 2010 SNPs in the FCER1A gene region show no association with allergic rhinitis in a Han Chinese population.
20691829 2010 Joint effects of common genetic variants from multiple genes and pathways on the risk of premature coronary artery disease.
20664273 2011 IgE-dependent and IgE-independent stimulation of human basophils increases the presence of immature Fc?RI? by reversing degradative pathways.
20603037 2010 Single nucleotide polymorphisms in inflammation-related genes are associated with venous thromboembolism.
20523060 2010 Prolonged culture of mast cells with high-glucose medium enhances the Fc epsilon RI-mediated degranulation response and leukotriene C4 production.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20410486 2010 Counterregulation between the FcepsilonRI pathway and antiviral responses in human plasmacytoid dendritic cells.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20163202 2010 An association between functional FceRIalpha polymorphisms and total serum IgE levels in patients with inflammatory bowel disease.
20141544 2010 FcepsilonRIalpha gene (FCER1A) promoter polymorphisms and total serum IgE levels in Japanese atopic dermatitis patients.
20126404 2010 The high affinity IgE receptor Fc epsilonRI is expressed by human intestinal epithelial cells.
20117843 2010 Substance P downregulates expression of the high affinity IgE receptor (FcepsilonRI) by human mast cells.
20028371 2010 Analysis of the high affinity IgE receptor genes reveals epistatic effects of FCER1A variants on eczema risk.
19748979 2009 Antitumor IgE adjuvanticity: key role of Fc epsilon RI.
19697153 2011 Specific post-transcriptional inhibition of mRNA for ligand binding chain of IgE high affinity receptor.
19685047 2009 FcepsilonRIalpha gene -18483A>C polymorphism affects transcriptional activity through YY1 binding.
19555572 2009 [Single nucleotide polymorphism in asthma predisposing genes in children in Shanghai].
19514647 2009 Genetic associations of variants of the high affinity receptor for immunoglobulin E in Wegener's granulomatosis.
19494509 2009 Proteomic Approach to FcepsilonRI aggregation-initiated signal transduction cascade in human mast cells.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19385959 2009 Counter regulation of the high affinity IgE receptor, FcepsilonRI, on human airway dendritic cells by IL-4 and IL-10.
19372141 2009 Candidate gene approach evaluates association between innate immunity genes and breast cancer risk in Korean women.
19359220 2009 Expression of the high affinity IgE receptor by neutrophils of individuals with allergic asthma is both minimal and insensitive to regulation by serum IgE.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19245427 2009 Common variants in FCER1A influence total serum IgE levels from cord blood up to six years of life.
19164348 2009 FcepsilonRI-mediated thymic stromal lymphopoietin production by interleukin-4-primed human mast cells.
19150851 2009 Polymerization of actin does not regulate desensitization in human basophils.
19141351 2009 The role of the high-affinity IgE receptor, FcepsilonRI, in eosinophilic gastrointestinal diseases.
19082920 Positive and negative regulatory mechanisms in high-affinity IgE receptor-mediated mast cell activation.
18846228 2008 Genome-wide scan on total serum IgE levels identifies FCER1A as novel susceptibility locus.
18726713 2009 Genetic variability of the high-affinity IgE receptor alpha-subunit (FcepsilonRIalpha).
18680511 2008 FCER1A gene proximal promoter polymorphisms in Caucasians and East Asians.
18595682 2008 Association of three sets of high-affinity IgE receptor (FcepsilonR1) polymorphisms with aspirin-intolerant asthma.
18523286 2008 Two different transcription factors discriminate the -315C>T polymorphism of the Fc epsilon RI alpha gene: binding of Sp1 to -315C and of a high mobility group-related molecule to -315T.
18394141 2008 FCER1A gene exon 1A polymorphisms in Japanese and Polish subjects--a comparative analysis of haplotypes.
18382690 2008 Regulation of the high affinity IgE receptor (Fc epsilonRI) in human neutrophils: role of seasonal allergen exposure and Th-2 cytokines.
18356810 2008 Basophil phenotypes in chronic idiopathic urticaria in relation to disease activity and autoantibodies.
18321309 2008 Association of interleukin-1 receptor antagonist +2018 gene polymorphism with Japanese chronic periodontitis patients using a novel genotyping method.
18187193 2008 Generation of canine-human Fc IgE chimeric antibodies for the determination of the canine IgE domain of interaction with Fc epsilon RI alpha.
18179824 2008 Role of the extracellular domain of Fc epsilon RI alpha in intracellular processing and surface expression of the high affinity receptor for IgE Fc epsilon RI.
18036650 2008 Inhibition of FcepsilonRI-dependent mediator release and calcium flux from human mast cells by sialic acid-binding immunoglobulin-like lectin 8 engagement.
17993265 2008 Kit- and Fc epsilonRI-induced differential phosphorylation of the transmembrane adaptor molecule NTAL/LAB/LAT2 allows flexibility in its scaffolding function in mast cells.
17965580 2007 Genetic variability of the high-affinity IgE receptor alpha subunit (Fc epsilon RI alpha) is related to total serum IgE levels in allergic subjects.
17903293 2007 Genome-wide association with select biomarker traits in the Framingham Heart Study.
17883736 2007 Coding region for the high affinity receptor of immunoglobulin E is highly conservative in allergic patients.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17686114 2007 Additive association between FCER1A and FCER1B genetic polymorphisms and total serum IgE levels.
17541278 2007 IgE- and FcepsilonRI-mediated enhancement of surface CD69 expression in basophils: role of low-level stimulation.
17521040 2007 Genetic polymorphisms of the novel FCERIA gene region: relation to total serum IgE levels.
17430357 2007 Association and functional relevance of E237G, a polymorphism of the high-affinity immunoglobulin E-receptor beta chain gene, to airway hyper-responsiveness.
17267694 2007 Activated N-formyl peptide receptor and high-affinity IgE receptor occupy common domains for signaling and internalization.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
17165285 2006 Novel exon 2A of the high-affinity receptor for the IgE alpha-chain gene (FCER1A) and autoimmunity in patients with asthma or urticaria.
17125826 2007 Significant association of FcepsilonRIalpha promoter polymorphisms with aspirin-intolerant chronic urticaria.
16709862 2006 Different stabilities of the structurally related receptors for IgE and IgG on the cell surface are determined by length of the stalk region in their alpha-chains.
16581830 2006 The high-affinity IgE receptor (FcepsilonRI): a critical regulator of airway smooth muscle cells?
16563391 2006 Catalytic folding of the Cepsilon3 domain by its high affinity receptor.
16459334 2006 Transport of the IgE receptor alpha-chain is controlled by a multicomponent intracellular retention signal.
16339523 2005 Increased expression of genes linked to FcepsilonRI Signaling and to cytokine and chemokine production in Lyn-deficient mast cells.
16237063 2005 TLR9- and FcepsilonRI-mediated responses oppose one another in plasmacytoid dendritic cells by down-regulating receptor expression.
16081836 2005 Human airway smooth muscle cells express the high affinity receptor for IgE (Fc epsilon RI): a critical role of Fc epsilon RI in human airway smooth muscle cell function.
15743766 2005 Disulfide linkage controls the affinity and stoichiometry of IgE Fcepsilon3-4 binding to FcepsilonRI.
15696081 2005 FcepsilonRI-mediated amphiregulin production by human mast cells increases mucin gene expression in epithelial cells.
15562891 2004 The E237G polymorphism of the high-affinity IgE receptor beta chain and asthma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15373772 2004 Transforming growth factor-beta1 regulates the expression of the high-affinity receptor for IgE on CD34 stem cell-derived CD1a dendritic cells in vitro.
15217825 2004 Kit and FcepsilonRI mediate unique and convergent signals for release of inflammatory mediators from human mast cells.
15140034 2004 A novel polymorphism of FcalphaRI (CD89) associated with aggressive periodontitis.
14746805 2003 Recombinant human (rh) stem cell factor and rhIL-4 stimulate differentiation and proliferation of CD3+ cells from umbilical cord blood and CD3+ cells enhance FcepsilonR1 expression on fetal liver-derived mast cells in the presence of rhIL-4.
14655898 2003 Genetic factors and asthma in aluminum smelter workers.
13129935 2003 The phospholipase C gamma 1-dependent pathway of Fc epsilon RI-mediated mast cell activation is regulated independently of phosphatidylinositol 3-kinase.
12902495 2003 A novel -66T/C polymorphism in Fc epsilon RI alpha-chain promoter affecting the transcription activity: possible relationship to allergic diseases.
12897750 2003 Surface expression of Fc epsilon RI on Langerhans' cells of clinically uninvolved skin is associated with disease activity in atopic dermatitis, allergic asthma, and rhinitis.
12855579 2003 Identification of specific gene expression profiles in human mast cells mediated by Toll-like receptor 4 and FcepsilonRI.
12671054 2003 Evidence for a differential expression of the FcepsilonRIgamma chain in dendritic cells of atopic and nonatopic donors.
12646639 2003 Regulation of the human Fc epsilon RI alpha-chain distal promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12270716 2002 Efficient folding of the FcepsilonRI alpha-chain membrane-proximal domain D2 depends on the presence of the N-terminal domain D1.
12217383 2002 Transcriptional regulation of the human high affinity IgE receptor alpha-chain gene.
12200378 2002 Regulation of FcepsilonRI-mediated degranulation by an adaptor protein 3BP2 in rat basophilic leukemia RBL-2H3 cells.
12070183 2002 Sequence variants in the FcepsilonRI alpha chain gene.
11776381 2001 Genetic polymorphisms in the promoter and 5' UTR region of the Fc alpha receptor (CD89) are not associated with a risk of IgA nephropathy.
11531339 2001 The analysis of the human high affinity IgE receptor Fc epsilon Ri alpha from multiple crystal forms.
11409901 2001 Cloning of full-length genomic DNA encoding human FcepsilonRI alpha-chain and its transcriptional regulation.
10917520 2000 Structure of the Fc fragment of human IgE bound to its high-affinity receptor Fc epsilonRI alpha.
9875849 1998 Crystal structure of the human high-affinity IgE receptor.
8752908 1996 Peripheral blood dendritic cells express Fc epsilon RI as a complex composed of Fc epsilon RI alpha- and Fc epsilon RI gamma-chains and can use this receptor for IgE-mediated allergen presentation.
8613143 1996 Fine mapping of the human pentraxin gene region on chromosome 1q23.
8245459 1993 Characterization of the gene for the human high affinity IgE receptor (Fc epsilon RI) alpha-chain.
8125119 1994 High-level expression of the truncated alpha chain of human high-affinity receptor for IgE as a soluble form by baculovirus-infected insect cells. Biochemical characterization of the recombinant product.
2967464 1988 Isolation of the gene coding for the alpha subunit of the human high affinity IgE receptor.
2964640 1988 Human and rat mast cell high-affinity immunoglobulin E receptors: characterization of putative alpha-chain gene products.
2146219 1990 The human genes for the alpha and gamma subunits of the mast cell receptor for immunoglobulin E are located on human chromosome band 1q23.
1535625 1992 The gene and cDNA for the human high affinity immunoglobulin E receptor beta chain and expression of the complete human receptor.
1533243 1992 Epidermal Langerhans cells from normal human skin bind monomeric IgE via Fc epsilon RI.
1472946 1992 A modeling study of the alpha-subunit of human high-affinity receptor for immunoglobulin-E.