Property Summary

NCBI Gene PubMed Count 69
PubMed Score 117.77
PubTator Score 197.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
gastric cancer -1.400 1.5e-03
tuberculosis -2.300 9.3e-04
lung cancer -1.600 4.2e-03
non primary Sjogren syndrome sicca -1.200 2.0e-02
COPD -1.200 8.8e-03
mucosa-associated lymphoid tissue lympho... 2.526 1.1e-02
axial spondyloarthropathy 1.400 4.4e-02
psoriasis 1.100 2.0e-12

Gene RIF (44)

PMID Text
25907714 Findings suggest a basis for the use of Fc receptor I for IgA (FcalphaRI) as a molecular target for the treatment of lupus.
25339672 induces different forms of neutrophil death, depending on the inflammatory microenvironment
24732061 this study examined the expression of IL-4 mRNA, IFN-c mRNA and FcaRI mRNA in tonsillar mononuclear cells of IgA nephropathy9(IgAN) patients and non-IgAN patients.
21985370 These results suggest a role of anti-FcaRI Fab as a negative regulator in controlling the magnitude of the innate immune response
21866091 Abnormally glycosylated IgA1 and soluble CD89-IgA and IgA-IgG complexes, features of primary IgA nephropathy, are also present in alcoholic cirrhosis.
21784854 Glycosylation of the CH2/CH3 interface inhibits interaction with the pathogen IgA binding protein SSL7, while maintaining binding of pIgR, essential to the biosynthesis and transport of SIgA.
21750160 FCAR polymorphism is not associated with high susceptibility to IGA nephropathy in caucasians.
21653835 In this study, human mammary carcinoma cells are efficiently killed when incubated with human neutrophils and tumor-specific FcalphaRI bispecific or immunoglobulin A antibodies.
21383176 FcalphaRI defines a function for pentraxins in inflammatory responses involving neutrophils and macrophages. It also highlights the innate aspect of otherwise humoral immunity-associated antibody receptors.
21273231 Genetic variation at the promoter region of IgA receptor is associated with IgA nephropathy.
21159834 Data show that the Fc(alpha)RI 844 A>G polymorphism is not associated with systemic sclerosis or rheumatoid arthritis sceptibility.
21037509 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20811333 There is an association between the levels of sCD89-IgA complexes in serum and the severity of IgA nephropathy, and a possible genetic component in regulating the production or expression of sCD89.
20811333 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19892918 Observational study of gene-disease association. (HuGE Navigator)
19859085 Endocytosis of FcalphaR is clathrin- and dynamin-dependent, but is not regulated by Rab5, and the endocytic motif is not located in the cytoplasmic domain of FcalphaR.
19555692 Immunoglobulin A: Fc(alpha)RI interactions induce neutrophil migration through release of leukotriene B4.
19497711 Observational study of gene-disease association. (HuGE Navigator)
19023099 Observational study of gene-disease association. (HuGE Navigator)
18700185 results suggest an endogenous mechanism by which FcalphaR functionality is down-regulated in an 'allergic environment' where FcepsilonRI is co-expressed and extensively cross-linked on FcalphaR-expressing effector cells
17975119 Observational study of gene-disease association. (HuGE Navigator)
17548632 Pathogen selection by bacterial decoy proteins drives FcalphaRI and IgA-Fc coevolution.
17393381 Fc alpha receptor type I activation mediates glomerulonephritis progression by initiating a cytokine/chemokine cascade that promotes leukocyte recruitment and kidney damage in transgenic mice.
17339498 Observational study of gene-disease association. (HuGE Navigator)
17033823 Observational study of gene-disease association. (HuGE Navigator)
17033823 FCAR promoter SNPs may be related to chronic HCV infection and disease progression in Japanese chronic hepatitis C.
17008591 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17008591 Carriers of 92Asn polymorphism in the myeloid IgA Fc receptor had increased risk of myocardial infarction in CARE and increased odds of coronary heart disease in WOSCOPS study groups.
16990604 On monomeric targeting, FcalphaRI functions as an FcRgamma ITAM-dependent apoptotic module that may be fundamental for controlling inflammation and tumor growth.
16876821 These results indicate that GPVI is unique amongst the receptors of its family as it uses different structural domains to interact with several agonists and provide evidence that different sites on GPVI constitute targets to develop antagonists of GPVI.
16627486 Fc receptor gamma RI interacts with the unrelated immunoreceptors FcalphaRI and FcepsilonRI [FCalphaRI, also called CD89]
16293625 Pathogenic group A and group B streptococci are well known to produce virulence factors that block the binding of IgA to the leukocyte IgA receptor, Fc alphaRI, thereby inhibiting IgA-mediated immunity.
15564774 Observational study of gene-disease association. (HuGE Navigator)
15371488 FcalphaRI expressed by interstitial-type dendritic cells could play a critical role to sample IgA-recognized antigens and also during dendritic cell activation.
12791088 expression pattern of CD89 and its signalling subunit, the FcR gamma chain, on circulating myeloid cells and in various tissues
12783876 Crystal structure of the ectodomain of human FcalphaRI
12768205 crystal structures of human FcalphaRI alone and in a complex with the Fc region of IgA1 (Fcalpha)
12634059 there is a bivalent, pH-dependent interaction between FcalphaRI and IgA with important implications for cytokine-dependent phagocytosis of IgA and the FcalphaRI-mediated degradation or recycling of IgA
12594283 The Fc alpha receptor 5'-flanking region from -102 to -64 relative to the ATG translation initiation codon is essential for promoter activity and contains two functional binding motifs for C/EBP and Ets family members at -74 and -92, respectively.
12560105 study suggests that expression of the FcR splice isoform DeltaEC2 but not Delta66EC2 is differentially regulated in a cell type-specific manner and in response to inflammatory and/or infectious processes
11801662 CD89 circulates in a high molecular mass form in complex covalently linked to IgA and contributes to the formation of polymeric serum IgA.
11281451 Observational study of gene-disease association. (HuGE Navigator)
8145026 Preincubation of monocytes with HIV-1 gp120 depresses anti-CD3 antibody-induced T cell stimulation and Fc receptor-mediated phagocytosis

AA Sequence

MDPKQTTLLCLVLCLGQRIQAQEGDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYRE      1 - 70
IGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRGLVLMPGE     71 - 140
NISLTCSSAHIPFDRFSLAKEGELSLPQHQSGEHPANFSLGPVDLNVSGIYRCYGWYNRSPYLWSFPSNA    141 - 210
LELVVTDSIHQDYTTQNLIRMAVAGLVLVALLAILVENWHSHTALNKEASADVAEPSWSQQMCQPGLTFA    211 - 280
RTPSVCK                                                                   281 - 287
//

Text Mined References (70)

PMID Year Title
25907714 2015 Targeted IgA Fc receptor I (Fc?RI) therapy in the early intervention and treatment of pristane-induced lupus nephritis in mice.
25339672 2014 Human IgA Fc receptor Fc?RI (CD89) triggers different forms of neutrophil death depending on the inflammatory microenvironment.
24732061 Expression and correlation analysis of IL-4, IFN-? and Fc?RI in tonsillar mononuclear cells in patients with IgA nephropathy.
21985370 2011 Negative regulation of inflammatory responses by immunoglobulin A receptor (Fc?RI) inhibits the development of Toll-like receptor-9 signalling-accelerated glomerulonephritis.
21866091 2011 Both IgA nephropathy and alcoholic cirrhosis feature abnormally glycosylated IgA1 and soluble CD89-IgA and IgG-IgA complexes: common mechanisms for distinct diseases.
21784854 2011 Interaction of human, rat, and mouse immunoglobulin A (IgA) with Staphylococcal superantigen-like 7 (SSL7) decoy protein and leukocyte IgA receptor.
21750160 2012 Single nucleotidic polymorphism 844 A->G of FCAR is not associated with IgA nephropathy in Caucasians.
21653835 2011 Targeting Fc?RI on polymorphonuclear cells induces tumor cell killing through autophagy.
21383176 2011 Recognition and functional activation of the human IgA receptor (FcalphaRI) by C-reactive protein.
21273231 2011 Association of -27T>C and its haplotype at the putative promoter for IgA-specific receptor gene with IgA nephropathy among the Chinese Han population.
21159834 2011 The functional polymorphism 844 A>G in Fc?RI (CD89) does not contribute to systemic sclerosis or rheumatoid arthritis susceptibility.
21037509 2010 Variants of ADAMTS1 modify the effectiveness of statins in reducing the risk of myocardial infarction.
20811333 2010 Association of soluble CD89 levels with disease progression but not susceptibility in IgA nephropathy.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19892918 2009 Genetic risk factors for periodontitis in a Japanese population.
19859085 2010 Endocytosis of FcalphaR is clathrin and dynamin dependent, but its cytoplasmic domain is not required.
19555692 2009 Immunoglobulin A: Fc(alpha)RI interactions induce neutrophil migration through release of leukotriene B4.
19497711 2009 Assessment of 14 functional gene polymorphisms in Japanese patients with oral lichen planus: a pilot case-control study.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18700185 2008 Functionality of the IgA Fc receptor (FcalphaR, CD89) is down-regulated by extensive engagement of FcepsilonRI.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17548632 2007 Episodes of natural selection shaped the interactions of IgA-Fc with FcalphaRI and bacterial decoy proteins.
17393381 2007 Fc alpha receptor I activation induces leukocyte recruitment and promotes aggravation of glomerulonephritis through the FcR gamma adaptor.
17339498 2007 FcalphaRI (CD89) alleles determine the proinflammatory potential of serum IgA.
17033823 2006 Genetic variants of the IgA Fc receptor (FcalphaR, CD89) promoter in chronic hepatitis C patients.
17008591 2006 Asp92Asn polymorphism in the myeloid IgA Fc receptor is associated with myocardial infarction in two disparate populations: CARE and WOSCOPS.
16990604 2007 IgA Fc receptor I signals apoptosis through the FcRgamma ITAM and affects tumor growth.
16876821 2006 Chimeric Fc receptors identify ligand binding regions in human glycoprotein VI.
16627486 2006 A common site of the Fc receptor gamma subunit interacts with the unrelated immunoreceptors FcalphaRI and FcepsilonRI.
16293625 2006 A competitive mechanism for staphylococcal toxin SSL7 inhibiting the leukocyte IgA receptor, Fc alphaRI, is revealed by SSL7 binding at the C alpha2/C alpha3 interface of IgA.
15564774 2004 Are single nucleotide polymorphisms of the immunoglobulin A Fc receptor gene associated with allergic asthma?
15555551 2004 The human pituitary nitroproteome: detection of nitrotyrosyl-proteins with two-dimensional Western blotting, and amino acid sequence determination with mass spectrometry.
15489335 2004 Human ORFeome version 1.1: a platform for reverse proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15371488 2004 Differential expression and function of IgA receptors (CD89 and CD71) during maturation of dendritic cells.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14759258 2004 An unappreciated role for RNA surveillance.
12791088 2003 Expression and modulation of the human immunoglobulin A Fc receptor (CD89) and the FcR gamma chain on myeloid cells in blood and tissue.
12783876 2003 Crystal structure of the ectodomain of human FcalphaRI.
12768205 2003 Insights into IgA-mediated immune responses from the crystal structures of human FcalphaRI and its complex with IgA1-Fc.
12634059 2003 Bivalent binding of IgA1 to FcalphaRI suggests a mechanism for cytokine activation of IgA phagocytosis.
12594283 2003 C/EBP alpha and Ets protein family members regulate the human myeloid IgA Fc receptor (Fc alpha R, CD89) promoter.
12560105 2003 Alternative splicing of myeloid IgA Fc receptor (Fc alpha R, CD89) transcripts in inflammatory responses.
12524384 2003 IgA Fc receptors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11929131 2002 Leukocyte Ig-like receptor complex (LRC) in mice and men.
11776381 2001 Genetic polymorphisms in the promoter and 5' UTR region of the Fc alpha receptor (CD89) are not associated with a risk of IgA nephropathy.
11478396 2001 CD89: the human myeloid IgA Fc receptor.
11281451 2001 Polymorphism in promoter region of Fcalpha receptor gene in patients with IgA nephropathy.
11003388 2000 Identification and characterization of the promoter for the gene encoding the human myeloid IgA Fc receptor (FcalphaR, CD89).
10835685 2000 FcalphaRI-positive liver Kupffer cells: reappraisal of the function of immunoglobulin A in immunity.
10438530 1999 Identification of residues in the CH2/CH3 domain interface of IgA essential for interaction with the human fcalpha receptor (FcalphaR) CD89.
10380711 1999 Characterization of the human myeloid IgA Fc receptor I (CD89) gene in a cosmid clone.
10359575 1999 Immunoglobulin-binding sites of human FcalphaRI (CD89) and bovine Fcgamma2R are located in their membrane-distal extracellular domains.
9427690 1998 Physical and functional association of Fc alpha R with protein tyrosine kinase Lyn.
9367406 1997 IgA nephropathy-specific expression of the IgA Fc receptors (CD89) on blood phagocytic cells.
8954257 1996 Structure and function of human IgA Fc receptors (Fc alpha R).
8943858 1996 Cloning and characterization of Fc alpha Rb, a novel Fc alpha receptor (CD89) isoform expressed in eosinophils and neutrophils.
8917112 1996 Alternative splicing of IgA Fc receptor (CD89) transcripts.
8836118 1996 Alternative splicing of the human IgA Fc receptor CD89 in neutrophils and eosinophils.
8666916 1996 Localization of the binding site for the monocyte immunoglobulin (Ig) A-Fc receptor (CD89) to the domain boundary between Calpha2 and Calpha3 in human IgA1.
8666819 1996 Identification of Fc alpha receptor (CD89) isoforms generated by alternative splicing that are differentially expressed between blood monocytes and alveolar macrophages.
8575829 1996 Alternatively spliced forms of the human myeloid Fc alpha receptor (CD89) in neutrophils.
8530370 1995 Functional association between the human myeloid immunoglobulin A Fc receptor (CD89) and FcR gamma chain. Molecular basis for CD89/FcR gamma chain association.
8408621 1993 Definition of immunoglobulin A receptors on eosinophils and their enhanced expression in allergic individuals.
7636188 1995 Structure of the gene for the human myeloid IgA Fc receptor (CD89).
7522255 1994 Association of IgA-Fc receptors (Fc alpha R) with Fc epsilon RI gamma 2 subunits in U937 cells. Aggregation induces the tyrosine phosphorylation of gamma 2.
2258698 1990 Expression cloning of a human Fc receptor for IgA.
1577457 1992 The gene for the human IgA Fc receptor maps to 19q13.4.