Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ependymoma 4679 2.0e-07
ovarian cancer 8520 8.5e-06

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma 1.300 2.0e-07
ovarian cancer 1.100 8.5e-06

AA Sequence

MELPLGRCDDSRTWDDDSDPESETDPDAQAKAYVARVLSPPKSGLAFSRPSQLSTPAASPSASEPRAASR      1 - 70
VSAVSEPGLLSLPPELLLEICSYLDARLVLHVLSRVCHALRDLVSDHVTWRLRALRRVRAPYPVVEEKNF     71 - 140
DWPAACIALEQHLSRWAEDGRWVEYFCLAEGHVASVDSVLLLQGGSLCLSGSRDRNVNLWDLRQLGTESN    141 - 210
QVLIKTLGTKRNSTHEGWVWSLAAQDHRVCSGSWDSTVKLWDMAADGQQFGEIKASSAVLCLSYLPDILV    211 - 280
TGTYDKKVTIYDPRDRMETRDALMGWGGPSRGSDIPPHRPITHEAGPALLKHQQLHSRPVLTLLADDRHI    281 - 350
ISGSEDHTLVVVDRRANSVLQRLQLDSYLLCMSYQEPQLWAGDNQGLLHVFANRNGCFQLIRSFDVGHSF    351 - 420
PITGIQYSVGALYTTSTDKTIRVHVPTDPPRTICTRRHDNGLNRVCAEGNLVVAGSGDLSLEVWRLQA      421 - 488
//

Text Mined References (14)

PMID Year Title