Property Summary

NCBI Gene PubMed Count 20
PubMed Score 5.84
PubTator Score 8.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Bladder Neoplasm 109
Disease Target Count Z-score Confidence
3-M syndrome 16 3.783 1.9

Expression

Gene RIF (8)

PMID Text
25790475 FBXW8 and PARK2 are sequestrated into insolubility by ATXN2 PolyQ expansions, but only FBXW8 expression is dysregulated
24973709 findings will shed light the role to mechanism of miR-218 in regulating JEG-3 cells proliferation via miR-218/Fbxw8 axis, and miR-218 may serve as a novel potential therapeutic target in human choriocarcinoma in the future
24362026 CUL7/Fbxw8 ubiquitin ligase-mediated HPK1 degradation revealed a direct link and novel role of CUL7/Fbxw8 ubiquitin ligase in the MAPK pathway, which plays a critical role in cell proliferation and differentiation.
23029530 Growth factor-stimulated TBC1D3 ubiquitination and degradation are regulated by its interaction with CUL7-Fbw8.
22524683 Dysregulation of Cul7 and Fbxw8 expression might affect trophoblast turnover in intrauterine growth restriction.
20878477 Fbxw8 plays an essential role in the proliferation of human trophoblast cells, especially JEG-3 cells.
17998335 FBXW8-CUL7 complex plays a significant role in growth control
17205132 FBXW8 plays an essential role in cancer cell proliferation through proteolysis of cyclin D1. It may present new opportunities to develop therapies targeting destruction of cyclin D1 or its regulator E3 ligase selectively.

AA Sequence

MDDYSLDEFRRRWQEELAQAQAPKKRRRPEAAERRARRPEVGSGRGEQASGDPALAQRLLEGAGRPPAAR      1 - 70
ATRAEGQDVASRSRSPLAREGAGGGEQLVDQLIRDLNEMNDVPFFDIQLPYELAINIFQYLDRKELGRCA     71 - 140
QVSKTWKVIAEDEVLWYRLCQQEGHLPDSSISDYSCWKLIFQECRAKEHMLRTNWKNRKGAVSELEHVPD    141 - 210
TVLCDVHSHDGVVIAGYTSGDVRVWDTRTWDYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAAYEDGF    211 - 280
LNIWDLRTGKYPVHRFEHDARIQALALSQDDATVATASAFDVVMLSPNEEGYWQIAAEFEVPKLVQYLEI    281 - 350
VPETRRYPVAVAAAGDLMYLLKAEDSARTLLYAHGPPVTCLDVSANQVAFGVQGLGWVYEGSKILVYSLE    351 - 420
AGRRLLKLGNVLRDFTCVNLSDSPPNLMVSGNMDGRVRIHDLRSGNIALSLSAHQLRVSAVQMDDWKIVS    421 - 490
GGEEGLVSVWDYRMNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHRGLIRAYE    491 - 560
FAVDQLAFQSPLPVCRSSCDAMATHYYDLALAFPYNHV                                    561 - 598
//

Text Mined References (24)

PMID Year Title
25790475 2015 Both ubiquitin ligases FBXW8 and PARK2 are sequestrated into insolubility by ATXN2 PolyQ expansions, but only FBXW8 expression is dysregulated.
24973709 2014 MicroRNA-218 inhibits the proliferation of human choriocarcinoma JEG-3 cell line by targeting Fbxw8.
24793695 2014 The 3M complex maintains microtubule and genome integrity.
24362026 2014 The CUL7/F-box and WD repeat domain containing 8 (CUL7/Fbxw8) ubiquitin ligase promotes degradation of hematopoietic progenitor kinase 1.
23029530 2012 Ubiquitination and degradation of the hominoid-specific oncoprotein TBC1D3 is mediated by CUL7 E3 ligase.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22524683 2012 Cullin 7 and Fbxw 8 expression in trophoblastic cells is regulated via oxygen tension: implications for intrauterine growth restriction?
22504417 2012 Identification of common variants associated with human hippocampal and intracranial volumes.
21572988 2011 An OBSL1-Cul7Fbxw8 ubiquitin ligase signaling mechanism regulates Golgi morphology and dendrite patterning.
20878477 2011 Fbxw8 is involved in the proliferation of human choriocarcinoma JEG-3 cells.
18498745 2008 The CUL7 E3 ubiquitin ligase targets insulin receptor substrate 1 for ubiquitin-dependent degradation.
17998335 2008 Disruption of the Fbxw8 gene results in pre- and postnatal growth retardation in mice.
17332328 2007 PARC and CUL7 form atypical cullin RING ligase complexes.
17314511 2007 Large-scale identification of c-MYC-associated proteins using a combined TAP/MudPIT approach.
17205132 2006 A critical role for FBXW8 and MAPK in cyclin D1 degradation and cancer cell proliferation.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15070733 2004 M-phase kinases induce phospho-dependent ubiquitination of somatic Wee1 by SCFbeta-TrCP.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12904573 2003 Targeted disruption of p185/Cul7 gene results in abnormal vascular morphogenesis.
12481031 2002 CUL7: A DOC domain-containing cullin selectively binds Skp1.Fbx29 to form an SCF-like complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10531037 1999 A family of mammalian F-box proteins.
10531035 1999 Identification of a family of human F-box proteins.