Property Summary

NCBI Gene PubMed Count 19
PubMed Score 14.62
PubTator Score 21.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
adult high grade glioma -1.100 8.6e-05
medulloblastoma, large-cell -1.100 8.0e-04
osteosarcoma -1.059 1.7e-03

Protein-protein Interaction (14)

Gene RIF (4)

AA Sequence

MAAAAGEEEEEEEAARESAARPAAGPALWRLPEELLLLICSYLDMRALGRLAQVCRWLRRFTSCDLLWRR      1 - 70
IARASLNSGFTRLGTDLMTSVPVKERVKVSQNWRLGRCREGILLKWRCSQMPWMQLEDDSLYISQANFIL     71 - 140
AYQFRPDGASLNRRPLGVFAGHDEDVCHFVLANSHIVSAGGDGKIGIHKIHSTFTVKYSAHEQEVNCVDC    141 - 210
KGGIIVSGSRDRTAKVWPLASGRLGQCLHTIQTEDRVWSIAISPLLSSFVTGTACCGHFSPLRIWDLNSG    211 - 280
QLMTHLGSDFPPGAGVLDVMYESPFTLLSCGYDTYVRYWDLRTSVRKCVMEWEEPHDSTLYCLQTDGNHL    281 - 350
LATGSSYYGVVRLWDRRQRACLHAFPLTSTPLSSPVYCLRLTTKHLYAALSYNLHVLDFQNP            351 - 412
//

Text Mined References (19)

PMID Year Title