Property Summary

NCBI Gene PubMed Count 18
PubMed Score 87.16
PubTator Score 6.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Rheumatoid Arthritis 1.400 3.8e-03
psoriasis -1.200 1.4e-03
osteosarcoma -1.532 8.4e-06
atypical teratoid / rhabdoid tumor -1.700 2.5e-03
glioblastoma -1.100 1.6e-02
medulloblastoma, large-cell -1.500 2.6e-03
group 4 medulloblastoma 1.200 8.1e-05
ovarian cancer -2.200 4.9e-07
dermatomyositis 1.100 8.3e-04

Gene RIF (3)

PMID Text
23651062 RACK1 competes with GCM1 for FBW2 and thereby prevents GCM1 ubiquitination, which is also supported by the observation that GCM1 is destabilized in RACK1-knockdown BeWo placental cells
18703417 UBE2D2 is required for GCMa ubiquitination and for association with the SCF(FBXW2) complex.
15640526 the SCF(hFBW2) E3 complex has a key role in targeting hGCMa to the ubiquitin-proteasome degradation system

AA Sequence

MERKDFETWLDNISVTFLSLTDLQKNETLDHLISLSGAVQLRHLSNNLETLLKRDFLKLLPLELSFYLLK      1 - 70
WLDPQTLLTCCLVSKQWNKVISACTEVWQTACKNLGWQIDDSVQDALHWKKVYLKAILRMKQLEDHEAFE     71 - 140
TSSLIGHSARVYALYYKDGLLCTGSDDLSAKLWDVSTGQCVYGIQTHTCAAVKFDEQKLVTGSFDNTVAC    141 - 210
WEWSSGARTQHFRGHTGAVFSVDYNDELDILVSGSADFTVKVWALSAGTCLNTLTGHTEWVTKVVLQKCK    211 - 280
VKSLLHSPGDYILLSADKYEIKIWPIGREINCKCLKTLSVSEDRSICLQPRLHFDGKYIVCSSALGLYQW    281 - 350
DFASYDILRVIKTPEIANLALLGFGDIFALLFDNRYLYIMDLRTESLISRWPLPEYRKSKRGSSFLAGEA    351 - 420
SWLNGLDGHNDTGLVFATSMPDHSIHLVLWKEHG                                        421 - 454
//

Text Mined References (21)

PMID Year Title
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
23651062 2013 RACK1 (receptor for activated C-kinase 1) interacts with FBW2 (F-box and WD-repeat domain-containing 2) to up-regulate GCM1 (glial cell missing 1) stability and placental cell migration and invasion.
23108047 2012 FBXW7-mediated degradation of CCDC6 is impaired by ATM during DNA damage response in lung cancer cells.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22632967 2012 Cyclin F-mediated degradation of ribonucleotide reductase M2 controls genome integrity and DNA repair.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18703417 2008 Ubiquitin-conjugating enzyme UBE2D2 is responsible for FBXW2 (F-box and WD repeat domain containing 2)-mediated human GCM1 (glial cell missing homolog 1) ubiquitination and degradation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15640526 2005 FBW2 targets GCMa to the ubiquitin-proteasome degradation system.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15070733 2004 M-phase kinases induce phospho-dependent ubiquitination of somatic Wee1 by SCFbeta-TrCP.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14603323 2003 Degradation of Cdc25A by beta-TrCP during S phase and in response to DNA damage.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11238952 2001 ATF4 degradation relies on a phosphorylation-dependent interaction with the SCF(betaTrCP) ubiquitin ligase.
10828603 2000 Five human genes encoding F-box proteins: chromosome mapping and analysis in human tumors.
10531037 1999 A family of mammalian F-box proteins.
10531035 1999 Identification of a family of human F-box proteins.
9635407 1998 Combinatorial control in ubiquitin-dependent proteolysis: don't Skp the F-box hypothesis.
7670494 1995 Recurrent rearrangements in the high mobility group protein gene, HMGI-C, in benign mesenchymal tumours.