Property Summary

NCBI Gene PubMed Count 39
PubMed Score 5.61
PubTator Score 6.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma 1.100 1.1e-02
ependymoma 1.100 1.4e-02
oligodendroglioma 1.500 2.8e-03
psoriasis 1.300 1.6e-08
osteosarcoma 2.341 5.4e-06
atypical teratoid / rhabdoid tumor 1.900 1.9e-04
glioblastoma 1.300 2.8e-02
group 4 medulloblastoma 1.800 4.8e-03
medulloblastoma, large-cell 2.300 1.8e-05
Pick disease -1.100 6.8e-06
ovarian cancer -1.500 6.9e-05
dermatomyositis -1.200 4.5e-04

Gene RIF (10)

PMID Text
25332235 SCF(FBXW11) bound, polyubiquitylated, and destabilized RAPGEF2, a guanine nucleotide exchange factor that activates the small GTPase RAP1
23611780 Data indicate that miR-106b-25 cluster (miR-106b, miR-93 and miR-25) targets the 3'UTR of the beta-TRCP2 transcript and increases the expression of Snail.
22851693 Knockdown of beta-TrCP1 and beta-TrCP2 attenuated the K48-linked ubiquitination and degradation of IRAK1.
22190034 HIV-1 Vpu is identified to have a physical interaction with F-box and WD-40 domain protein 11 (FBXW11; FBW1B) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22045853 Data indicate that knockdown of beta-TrCP1 and beta-TrCP2 markedly reduced IL-17-induced, phosphorylation-dependent ubiquitination and degradation of Act1.
21138764 two splice variants of beta-transducin repeat containing protein 2 (BTRCP2) localise exclusively to either the nucleus or the cytosol.
18187620 HIV-1 Vpu is identified to have a physical interaction with F-box and WD-40 domain protein 11 (FBXW11; FBW1B) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
18187620 Knockdown of F-box and WD repeat domain containing 11 (FBXW11) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17121803 HIV-1 Vpu is identified to have a physical interaction with F-box and WD-40 domain protein 11 (FBXW11; FBW1B) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
16865294 FBXW11 may be the most likely candidate gene for the Holoprosencephaly and prexial polydactyly phenotype.

AA Sequence

MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQ      1 - 70
KEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAENILSYLD     71 - 140
ARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFKNRPTDGPPNSFYRSLYP    141 - 210
KIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHT    211 - 280
GSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASA    281 - 350
TDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGS    351 - 420
SDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVE    421 - 490
HSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR                      491 - 542
//

Text Mined References (49)

PMID Year Title
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25503564 2015 Degradation of Cep68 and PCNT cleavage mediate Cep215 removal from the PCM to allow centriole separation, disengagement and licensing.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25332235 2015 Substrate trapping proteomics reveals targets of the ?TrCP2/FBXW11 ubiquitin ligase.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
23611780 2013 MicroRNA-106b-25 cluster targets ?-TRCP2, increases the expression of Snail and enhances cell migration and invasion in H1299 (non small cell lung cancer) cells.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
22851693 2012 ?-TrCP-mediated IRAK1 degradation releases TAK1-TRAF6 from the membrane to the cytosol for TAK1-dependent NF-?B activation.
22682247 2012 Wnt signaling through inhibition of ?-catenin degradation in an intact Axin1 complex.
22045853 2011 Persistent stimulation with interleukin-17 desensitizes cells through SCF?-TrCP-mediated degradation of Act1.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21138764 2011 Specificity, location and function of ?TrCP isoforms and their splice variants.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20708156 2010 Phosphorylation by casein kinase I promotes the turnover of the Mdm2 oncoprotein via the SCF(beta-TRCP) ubiquitin ligase.
20347421 2010 Priming and extending: a UbcH5/Cdc34 E2 handoff mechanism for polyubiquitination on a SCF substrate.
19966869 2010 The ubiquitin-specific protease USP47 is a novel beta-TRCP interactor regulating cell survival.
19730691 2009 HIV-1 Vpu neutralizes the antiviral factor Tetherin/BST-2 by binding it and directing its beta-TrCP2-dependent degradation.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19159283 2009 Array MAPPIT: high-throughput interactome analysis in mammalian cells.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18575781 2008 Oxidative stress-induced ubiquitination of RCAN1 mediated by SCFbeta-TrCP ubiquitin ligase.
17510365 2007 Wilms tumor suppressor WTX negatively regulates WNT/beta-catenin signaling.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16885022 2006 SCFbetaTrCP-mediated degradation of Claspin regulates recovery from the DNA replication checkpoint response.
16880511 2006 Regulation of p27 degradation and S-phase progression by Ro52 RING finger protein.
16865294 2006 Holoprosencephaly and preaxial polydactyly associated with a 1.24 Mb duplication encompassing FBXW11 at 5q35.1.
15917222 2005 SCFbeta-TRCP controls clock-dependent transcription via casein kinase 1-dependent degradation of the mammalian period-1 (Per1) protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15337770 2004 Phosphorylation and specific ubiquitin acceptor sites are required for ubiquitination and degradation of the IFNAR1 subunit of type I interferon receptor.
15070733 2004 M-phase kinases induce phospho-dependent ubiquitination of somatic Wee1 by SCFbeta-TrCP.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14673179 2004 Dual effects of IkappaB kinase beta-mediated phosphorylation on p105 Fate: SCF(beta-TrCP)-dependent degradation and SCF(beta-TrCP)-independent processing.
14603323 2003 Degradation of Cdc25A by beta-TrCP during S phase and in response to DNA damage.
14532120 2003 SCF(HOS) ubiquitin ligase mediates the ligand-induced down-regulation of the interferon-alpha receptor.
12482991 2003 betaTrCP-mediated proteolysis of NF-kappaB1 p105 requires phosphorylation of p105 serines 927 and 932.
12481031 2002 CUL7: A DOC domain-containing cullin selectively binds Skp1.Fbx29 to form an SCF-like complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11896578 2002 Mouse homologue of HOS (mHOS) is overexpressed in skin tumors and implicated in constitutive activation of NF-kappaB.
11850814 2002 Inhibition of HOS expression and activities by Wnt pathway.
11158290 2001 Shared pathways of IkappaB kinase-induced SCF(betaTrCP)-mediated ubiquitination and degradation for the NF-kappaB precursor p105 and IkappaBalpha.
10694485 2000 Molecular cloning and genomic structure of the betaTRCP2 gene on chromosome 5q35.1.
10648623 2000 The SCF(HOS/beta-TRCP)-ROC1 E3 ubiquitin ligase utilizes two distinct domains within CUL1 for substrate targeting and ubiquitin ligation.
10644755 2000 Homodimer of two F-box proteins betaTrCP1 or betaTrCP2 binds to IkappaBalpha for signal-dependent ubiquitination.
10531035 1999 Identification of a family of human F-box proteins.
10437795 1999 A complex containing betaTrCP recruits Cdc34 to catalyse ubiquitination of IkappaBalpha.
10321728 1999 HOS, a human homolog of Slimb, forms an SCF complex with Skp1 and Cullin1 and targets the phosphorylation-dependent degradation of IkappaB and beta-catenin.
10066435 1999 IkappaBalpha ubiquitination is catalyzed by an SCF-like complex containing Skp1, cullin-1, and two F-box/WD40-repeat proteins, betaTrCP1 and betaTrCP2.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.