Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.33
PubTator Score 2.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Rheumatoid Arthritis 1.400 1.2e-02
Waldenstrons macroglobulinemia 1.424 6.1e-03
Multiple myeloma 1.210 4.6e-03
astrocytic glioma 1.300 3.3e-03
posterior fossa group A ependymoma -1.300 2.5e-10
cutaneous lupus erythematosus -1.100 3.7e-03
psoriasis 1.600 3.8e-08
osteosarcoma -1.490 4.9e-03
glioblastoma -2.300 4.3e-05
atypical teratoid / rhabdoid tumor -2.300 3.9e-07
group 3 medulloblastoma 1.300 2.7e-02
medulloblastoma, large-cell -2.900 6.5e-06
non-small cell lung cancer -1.456 4.5e-17
intraductal papillary-mucinous neoplasm ... 1.100 1.3e-02
active ulcerative colitis -1.059 9.0e-03
cystic fibrosis -1.600 2.7e-05
adult high grade glioma -2.200 3.1e-06
pilocytic astrocytoma -1.200 9.9e-04
non primary Sjogren syndrome sicca -1.100 1.8e-02
Pick disease -1.300 1.0e-04
Breast cancer -1.100 1.6e-09
invasive ductal carcinoma -1.400 2.9e-02
ovarian cancer -2.300 5.2e-07
dermatomyositis 1.300 2.0e-04

Gene RIF (1)

PMID Text
20459822 ICK and FBX9 are divergently transcribed from a bidirectional promoter that is GC-rich and contains a CpG island.

AA Sequence

MPDIIWVFPPQAEAEEDCHSDTVRADDDEENESPAETDLQAQLQMFRAQWMFELAPGVSSSNLENRPCRA      1 - 70
ARGSLQKTSADTKGKQEQAKEEKARELFLKAVEEEQNGALYEAIKFYRRAMQLVPDIEFKITYTRSPDGD     71 - 140
GVGNSYIEDNDDDSKMADLLSYFQQQLTFQESVLKLCQPELESSQIHISVLPMEVLMYIFRWVVSSDLDL    141 - 210
RSLEQLSLVCRGFYICARDPEIWRLACLKVWGRSCIKLVPYTSWREMFLERPRVRFDGVYISKTTYIRQG    211 - 280
EQSLDGFYRAWHQVEYYRYIRFFPDGHVMMLTTPEEPQSIVPRLRTRNTRTDAILLGHYRLSQDTDNQTK    281 - 350
VFAVITKKKEEKPLDYKYRYFRRVPVQEADQSFHVGLQLCSSGHQRFNKLIWIHHSCHITYKSTGETAVS    351 - 420
AFEIDKMYTPLFFARVRSYTAFSERPL                                               421 - 447
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23263282 2013 SCFFbxo9 and CK2 direct the cellular response to growth factor withdrawal via Tel2/Tti1 degradation and promote survival in multiple myeloma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22632967 2012 Cyclin F-mediated degradation of ribonucleotide reductase M2 controls genome integrity and DNA repair.
20459822 2010 The promoter for intestinal cell kinase is head-to-head with F-Box 9 and contains functional sites for TCF7L2 and FOXA factors.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10531037 1999 A family of mammalian F-box proteins.
10531035 1999 Identification of a family of human F-box proteins.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.