Property Summary

NCBI Gene PubMed Count 15
PubMed Score 48.85
PubTator Score 22.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.131 2.0e-02
ovarian cancer -2.400 1.3e-08

Gene RIF (4)

PMID Text
25801334 FBX8 was markedly down-regulated in gastric cancer tissues. Knocking down FBX8 promoted proliferation and invasion in tumor cell line. Patients with low FBX8 had poor prognosis.
25550853 FBX8 down-expression was an independent prognostic indicator for glioma patient's survival.
20848231 FBX8 is a novel c-Myc binding protein and that c-Myc induces cell invasive activity
18987618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MGQGLWRVVRNQQLQQEGYSEQGYLTREQSRRMAASNISNTNHRKQVQGGIDIYHLLKARKSKEQEGFIN      1 - 70
LEMLPPELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCSIYNKNPPLGFSFRKLYMQLD     71 - 140
EGSLTFNANPDEGVNYFMSKGILDDSPKEIAKFIFCTRTLNWKKLRIYLDERRDVLDDLVTLHNFRNQFL    141 - 210
PNALREFFRHIHAPEERGEYLETLITKFSHRFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVK    211 - 280
NKMSKREFIRNTRRAAQNISEDFVGHLYDNIYLIGHVAA                                   281 - 319
//

Text Mined References (17)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25801334 2015 Significance of FBX8 in progression of gastric cancer.
25550853 2014 Down-expression of F box only protein 8 correlates with tumor grade and poor prognosis in human glioma.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
20848231 2010 c-Myc stimulates cell invasion by inhibiting FBX8 function.
18987618 2009 Screening for replication of genome-wide SNP associations in sporadic ALS.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10945468 2000 cDNA cloning and expression analysis of new members of the mammalian F-box protein family.
10531037 1999 A family of mammalian F-box proteins.
10531035 1999 Identification of a family of human F-box proteins.