Property Summary

NCBI Gene PubMed Count 41
PubMed Score 55.41
PubTator Score 43.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 2.000 3.8e-07
astrocytoma 1.100 3.0e-10
glioblastoma 1.800 6.2e-08
oligodendroglioma 1.400 2.0e-08
sonic hedgehog group medulloblastoma 2.900 8.3e-08
atypical teratoid / rhabdoid tumor 1.800 1.8e-07
medulloblastoma, large-cell 2.200 2.6e-05
primitive neuroectodermal tumor 2.100 6.7e-05
Atopic dermatitis 1.200 3.9e-04
adrenocortical carcinoma 1.145 2.0e-02
non-small cell lung cancer 1.279 5.3e-16
lung cancer 1.700 4.1e-03
colon cancer 1.600 9.7e-03
Breast cancer 2.400 3.0e-02
pediatric high grade glioma 1.900 9.5e-07
primary Sjogren syndrome 1.100 1.3e-02
nasopharyngeal carcinoma 1.300 5.3e-05
Endometriosis 1.105 4.4e-02
ductal carcinoma in situ 1.100 2.2e-02
invasive ductal carcinoma 1.200 1.1e-02
ovarian cancer 1.200 1.1e-02

Gene RIF (21)

PMID Text
24277465 Examined eoffect of Emi1 over-expression on Skp2 expression in breast cancer. Found expression of Emi1 was positively related with Skp2 expression; Emi1 expression correlated significantly with histologic grade. Skp2 expression obtained similar results.
24074588 Human papillomavirus type 16 E7 expression causes increased EMI1 mRNA expression and also inhibits EMI1 degradation.
23708605 The C-terminal domain inhibits multiple APC/C(CDH1) functions. The intrinsically disordered D-box, linker & tail elements, & a structured Zn-binding domain synergistically block the substrate-binding site & inhibit ubiquitin-chain elongation.
23645673 Emi1 depletion enhances the sensitivity of cancer cells to doxorubicin and x-ray irradiation.
23202783 Emi1 expression (>5%) was seen in 23.3% of ovarian clear cell carcinoma, and associated with high FIGO grades and poor overall survival
22995332 Emi1 participates in human hepatocellular carcinoma (HCC) cell proliferation and that progression is controlled by anaphase-promoting complex/cyclosome (APC/C) inhibition, which stabilized Skp2 and enabled p27(kip1) degradation.
21454540 the ability of Emi1 to inhibit APC/C is negatively regulated by CDKs
20800603 Observational study of gene-disease association. (HuGE Navigator)
20717963 Results suggest that Bcr-Abl increases Emi1 phosphorylation and stability to prevent Skp2 protein degradation via APC/Cdh1-induced ubiquitination and to enhance proliferation of CML cells.
20641033 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19822658 Results underscore the crucial role of cyclin A2-CDK2 in regulating the PLK1-SCF(beta-TrCP1)-EMI1-APC/C axis and CDC6 to trigger genome reduplication after the activity of CDK1 is suppressed.
19211842 Emi1 down-regulation and APC activation leads to stable p21-dependent G2 arrest after DNA damage.
18204430 We investigated Emi1 protein expression in ovarian neoplasms
17609108 critical spindle pole-associated mechanism, called the END (Emi1/NuMA/dynein-dynactin) network, spatially restricts APC/C activity in early mitosis
17485488 Emi1 plays a crucial role in the cell cycle to couple DNA replication with mitosis
17234884 These data suggest that Emi1 plays a critical role in preserving genome integrity by blocking rereplication, revealing a previously unrecognized function of this inhibitor of anaphase-promoting complex/cyclosome.
17190794 bservations reveal a novel mechanism for the control of entry into the first meiotic division: an Emi1-dependent inhibition of APC(Cdh1).
16921029 Emi1 associates in a complex with the anaphase-promoting complex/cyclosome (APC/C) and Cdh1; Emi1 binds to the APC/C via a conserved C-terminal destruction (D)-box and can compete for APC/C-substrate interaction.
16861914 loss of pRb repression of E2F-mediated transcription causing misregulation of Emi1 and APC/C substrates results in the generation of tetraploidy and proliferation of genomically unstable cells in the absence of normal p53 function
15469984 Plk1 activates the anaphase promoting complex by directing the SCF-dependent destruction of Emi1 in prophase
11988738 These data suggest that E2F can activate both transcription of cyclin A and the hEmi1-dependent stabilization of APC(Cdh1) targets, such as cyclin A, to promote S phase entry.

AA Sequence

MSRRPCSCALRPPRCSCSASPSAVTAAGRPRPSDSCKEESSTLSVKMKCDFNCNHVHSGLKLVKPDDIGR      1 - 70
LVSYTPAYLEGSCKDCIKDYERLSCIGSPIVSPRIVQLETESKRLHNKENQHVQQTLNSTNEIEALETSR     71 - 140
LYEDSGYSSFSLQSGLSEHEEGSLLEENFGDSLQSCLLQIQSPDQYPNKNLLPVLHFEKVVCSTLKKNAK    141 - 210
RNPKVDREMLKEIIARGNFRLQNIIGRKMGLECVDILSELFRRGLRHVLATILAQLSDMDLINVSKVSTT    211 - 280
WKKILEDDKGAFQLYSKAIQRVTENNNKFSPHASTREYVMFRTPLASVQKSAAQTSLKKDAQTKLSNQGD    281 - 350
QKGSTYSRHNEFSEVAKTLKKNESLKACIRCNSPAKYDCYLQRATCKREGCGFDYCTKCLCNYHTTKDCS    351 - 420
DGKLLKASCKIGPLPGTKKSKKNLRRL                                               421 - 447
//

Text Mined References (43)

PMID Year Title
24277465 2013 The expression and prognosis of Emi1 and Skp2 in breast carcinoma: associated with PI3K/Akt pathway and cell proliferation.
24074588 2013 Human papillomavirus type 16 E7 oncoprotein inhibits the anaphase promoting complex/cyclosome activity by dysregulating EMI1 expression in mitosis.
23708605 2013 Electron microscopy structure of human APC/C(CDH1)-EMI1 reveals multimodal mechanism of E3 ligase shutdown.
23645673 2013 Selective enhancing effect of early mitotic inhibitor 1 (Emi1) depletion on the sensitivity of doxorubicin or X-ray treatment in human cancer cells.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23202783 2013 Clear cell carcinomas of the ovary: a multi-institutional study of 129 cases in Korea with prognostic significance of Emi1 and Galectin-3.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22995332 2013 Early mitotic inhibitor-1, an anaphase-promoting complex/cyclosome inhibitor, can control tumor cell proliferation in hepatocellular carcinoma: correlation with Skp2 stability and degradation of p27(Kip1).
21454540 2011 Regulation of the action of early mitotic inhibitor 1 on the anaphase-promoting complex/cyclosome by cyclin-dependent kinases.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20717963 2011 Bcr-Abl-induced tyrosine phosphorylation of Emi1 to stabilize Skp2 protein via inhibition of ubiquitination in chronic myeloid leukemia cells.
20641033 2011 Polymorphisms in predicted miRNA binding sites and osteoporosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19822658 2009 Cyclin A2-cyclin-dependent kinase 2 cooperates with the PLK1-SCFbeta-TrCP1-EMI1-anaphase-promoting complex/cyclosome axis to promote genome reduplication in the absence of mitosis.
19211842 2009 DNA damage triggers p21WAF1-dependent Emi1 down-regulation that maintains G2 arrest.
18662541 2008 The Cdc14B-Cdh1-Plk1 axis controls the G2 DNA-damage-response checkpoint.
18204430 2008 Emi1 protein accumulation implicates misregulation of the anaphase promoting complex/cyclosome pathway in ovarian clear cell carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17719540 2007 A bacterial effector targets Mad2L2, an APC inhibitor, to modulate host cell cycling.
17676996 2007 Regulated degradation of the HIV-1 Vpu protein through a betaTrCP-independent pathway limits the release of viral particles.
17609108 2007 The END network couples spindle pole assembly to inhibition of the anaphase-promoting complex/cyclosome in early mitosis.
17485488 2007 Emi1 is needed to couple DNA replication with mitosis but does not regulate activation of the mitotic APC/C.
17234884 2007 The APC/C inhibitor, Emi1, is essential for prevention of rereplication.
17190794 2007 Prophase I arrest and progression to metaphase I in mouse oocytes are controlled by Emi1-dependent regulation of APC(Cdh1).
16921029 2006 Emi1 stably binds and inhibits the anaphase-promoting complex/cyclosome as a pseudosubstrate inhibitor.
16861914 2006 Overexpression of the anaphase promoting complex/cyclosome inhibitor Emi1 leads to tetraploidy and genomic instability of p53-deficient cells.
16439210 2006 The evi5 oncogene regulates cyclin accumulation by stabilizing the anaphase-promoting complex inhibitor emi1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469984 2004 Plk1 regulates activation of the anaphase promoting complex by phosphorylating and triggering SCFbetaTrCP-dependent destruction of the APC Inhibitor Emi1.
15148369 2004 Role of Polo-like kinase in the degradation of early mitotic inhibitor 1, a regulator of the anaphase promoting complex/cyclosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12791267 2003 Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin ligase activates the anaphase promoting complex to allow progression beyond prometaphase.
12703993 2003 [Effect of beta-carotene on gene expression of breast cancer cells].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11988738 2002 E2F-dependent accumulation of hEmi1 regulates S phase entry by inhibiting APC(Cdh1).
11976684 2002 Emi1 is required for cytostatic factor arrest in vertebrate eggs.
11389834 2001 Emi1 is a mitotic regulator that interacts with Cdc20 and inhibits the anaphase promoting complex.
10828603 2000 Five human genes encoding F-box proteins: chromosome mapping and analysis in human tumors.
10531037 1999 A family of mammalian F-box proteins.
10531035 1999 Identification of a family of human F-box proteins.
10409428 1999 Gene expression in proliferating human erythroid cells.