Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.75
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (2)

PMID Text
23898208 HIV-1 Tat downregulates the expression of F-box protein 48 (FBXO48) in human primary T cells
23485738 mutations in the coding region of the FBXO48 gene play little or no role in the development of Parkinson diseases.

AA Sequence

MHKNSKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASLTCRSWNDTIR      1 - 70
NSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLSGRYSNICSPISLPEKIMYPM     71 - 140
DADTWGEILEAELER                                                           141 - 155
//

Text Mined References (4)

PMID Year Title
23485738 2013 Genetic analysis of the FBXO48 gene in Chinese Han patients with Parkinson disease.
22190364 2011 Genome-wide meta-analysis identifies novel multiple sclerosis susceptibility loci.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.