Property Summary

NCBI Gene PubMed Count 6
PubMed Score 10.10
PubTator Score 7.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -1.500 9.3e-03
ependymoma -1.700 9.4e-03
oligodendroglioma -1.400 1.4e-02
osteosarcoma 2.265 5.4e-07
atypical teratoid / rhabdoid tumor -1.600 1.0e-05
glioblastoma -1.700 5.2e-06
sonic hedgehog group medulloblastoma -1.300 3.9e-03
medulloblastoma, large-cell -1.400 5.1e-06
non-small cell lung cancer 1.490 3.8e-15
intraductal papillary-mucinous carcinoma... 1.200 3.7e-03
intraductal papillary-mucinous neoplasm ... 1.300 1.7e-03
pediatric high grade glioma -1.400 3.1e-06
pilocytic astrocytoma -1.200 1.3e-05
psoriasis 2.300 4.1e-18
subependymal giant cell astrocytoma -1.605 4.7e-03
Pick disease 1.900 1.2e-04
Breast cancer 1.100 1.1e-11
gastric carcinoma 1.200 2.2e-02
ovarian cancer 1.500 1.4e-03

Gene RIF (5)

PMID Text
25460509 Data show that epithelial-mesenchymal transition (EMT)-transcription factors can be dynamically degraded by an atypical ubiquitin E3 ligase complex Skp1-Pam-Fbxo45 (SPFFbxo45).
24992930 Fbxo45 is the substrate-receptor subunit of a functional E3 ligase for Par-4 that has a critical role in cancer cell survival.
24878430 Study found that the R108C mutation in FBXO45 is a rare variant with a modest effect on schizophrenia risk that may disrupt the structure and function of the FBXO45 protein
19581926 FBXO45 promotes the proteasome-dependent degradation of p73.
16012741 FBXO45 gene consisting of 3 exons, and the vicinity of the transcriptional start site had several estrogen receptor binding consensus sequences.

AA Sequence

MAAPAPGAGAASGGAGCSGGGAGAGAGSGSGAAGAGGRLPSRVLELVFSYLELSELRSCALVCKHWYRCL      1 - 70
HGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKIRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQS     71 - 140
TDGARTKIGFSEGRHAWEVWWEGPLGTVAVIGIATKRAPMQCQGYVALLGSDDQSWGWNLVDNNLLHNGE    141 - 210
VNGSFPQCNNAPKYQIGERIRVILDMEDKTLAFERGYEFLGVAFRGLPKVCLYPAVSAVYGNTEVTLVYL    211 - 280
GKPLDG                                                                    281 - 286
//

Text Mined References (10)

PMID Year Title
25460509 2015 Atypical ubiquitin E3 ligase complex Skp1-Pam-Fbxo45 controls the core epithelial-to-mesenchymal transition-inducing transcription factors.
24992930 2014 Fbxo45-mediated degradation of the tumor-suppressor Par-4 regulates cancer cell survival.
24878430 2014 Novel rare variants in F-box protein 45 (FBXO45) in schizophrenia.
21269460 2011 Initial characterization of the human central proteome.
19581926 2009 The F-box protein FBXO45 promotes the proteasome-dependent degradation of p73.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16012741 2005 Characterization of estrogen-induced F-box protein FBXO45.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.