Property Summary

NCBI Gene PubMed Count 11
PubMed Score 73.69
PubTator Score 5.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.6e-05
subependymal giant cell astrocytoma 2287 2.8e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Ebola hemorrhagic fever 13 3.516 1.8
Kwashiorkor 1 3.076 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.718 1.6e-05
subependymal giant cell astrocytoma -1.279 2.8e-02

 Compartment GO Term (2)

Gene RIF (4)

AA Sequence

MASSSDSEDDSFMAVDQEETVLEGTMDQDEEPHPVLEAEETRHNRSMSELPEEVLEYILSFLSPYQEHKT      1 - 70
AALVCKQWYRLIKGVAHQCYHGFMKAVQEGNIQWESRTYPYPGTPITQRFSHSACYYDANQSMYVFGGCT     71 - 140
QSSCNAAFNDLWRLDLNSKEWIRPLASGSYPSPKAGATLVVYKDLLVLFGGWTRPSPYPLHQPERFFDEI    141 - 210
HTYSPSKNWWNCIVTTHGPPPMAGHSSCVIDDKMIVFGGSLGSRQMSNDVWVLDLEQWAWSKPNISGPSP    211 - 280
HPRGGQSQIVIDDATILILGGCGGPNALFKDAWLLHMHSGPWAWQPLKVENEEHGAPELWCHPACRVGQC    281 - 350
VVVFSQAPSGRAPLSPSLNSRPSPISATPPALVPETREYRSQSPVRSMDEAPCVNGRWGTLRPRAQRQTP    351 - 420
SGSREGSLSPARGDGSPILNGGSLSPGTAAVGGSSLDSPVQAISPSTPSAPEGYDLKIGLSLAPRRGSLP    421 - 490
DQKDLRLGSIDLNWDLKPASSSNPMDGMDNRTVGGSMRHPPEQTNGVHTPPHVASALAGAVSPGALRRSL    491 - 560
EAIKAMSSKGPSASAALSPPLGSSPGSPGSQSLSSGETVPIPRPGPAQGDGHSLPPIARRLGHHPPQSLN    561 - 630
VGKPLYQSMNCKPMQMYVLDIKDTKEKGRVKWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQN    631 - 700
VKYYPKTNALYFVRAKR                                                         701 - 717
//

Text Mined References (16)

PMID Year Title