Property Summary

NCBI Gene PubMed Count 11
PubMed Score 66.19
PubTator Score 5.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.718 1.6e-05
subependymal giant cell astrocytoma -1.279 2.8e-02

 Compartment GO Term (2)

Gene RIF (4)

PMID Text
25792601 SCF(JFK) as a bona fide E3 ligase for ING4 and unraveled the JFK-ING4-NF-kappaB axis as an important player in the development and progression of breast cancer
24063688 The findings of this study suggest that a haplotype of the FBXO42 gene might be associated with a higher susceptibility to PD.
21127074 Substrate phosphorylation and feedback regulation in JFK-promoted p53 destabilization.
19509332 JFK promotes p53 turnover through assembly of an SCF (Skp1-Cul1-F-box) complex, revealing a pathway for the control of p53 degradation and providing a link between the SCF complex and p53 regulation.

AA Sequence

MASSSDSEDDSFMAVDQEETVLEGTMDQDEEPHPVLEAEETRHNRSMSELPEEVLEYILSFLSPYQEHKT      1 - 70
AALVCKQWYRLIKGVAHQCYHGFMKAVQEGNIQWESRTYPYPGTPITQRFSHSACYYDANQSMYVFGGCT     71 - 140
QSSCNAAFNDLWRLDLNSKEWIRPLASGSYPSPKAGATLVVYKDLLVLFGGWTRPSPYPLHQPERFFDEI    141 - 210
HTYSPSKNWWNCIVTTHGPPPMAGHSSCVIDDKMIVFGGSLGSRQMSNDVWVLDLEQWAWSKPNISGPSP    211 - 280
HPRGGQSQIVIDDATILILGGCGGPNALFKDAWLLHMHSGPWAWQPLKVENEEHGAPELWCHPACRVGQC    281 - 350
VVVFSQAPSGRAPLSPSLNSRPSPISATPPALVPETREYRSQSPVRSMDEAPCVNGRWGTLRPRAQRQTP    351 - 420
SGSREGSLSPARGDGSPILNGGSLSPGTAAVGGSSLDSPVQAISPSTPSAPEGYDLKIGLSLAPRRGSLP    421 - 490
DQKDLRLGSIDLNWDLKPASSSNPMDGMDNRTVGGSMRHPPEQTNGVHTPPHVASALAGAVSPGALRRSL    491 - 560
EAIKAMSSKGPSASAALSPPLGSSPGSPGSQSLSSGETVPIPRPGPAQGDGHSLPPIARRLGHHPPQSLN    561 - 630
VGKPLYQSMNCKPMQMYVLDIKDTKEKGRVKWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQN    631 - 700
VKYYPKTNALYFVRAKR                                                         701 - 717
//

Text Mined References (16)

PMID Year Title
25792601 2015 SCF(JFK) is a bona fide E3 ligase for ING4 and a potent promoter of the angiogenesis and metastasis of breast cancer.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
24063688 2013 Genetic analysis of the FBXO42 gene in Chinese Han patients with Parkinson's disease.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21127074 2011 Substrate phosphorylation and feedback regulation in JFK-promoted p53 destabilization.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19509332 2009 JFK, a Kelch domain-containing F-box protein, links the SCF complex to p53 regulation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.