Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.39
PubTator Score 2.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -2.200 8.6e-05
astrocytic glioma -1.300 1.8e-03
Astrocytoma, Pilocytic -2.200 2.0e-08
atypical teratoid / rhabdoid tumor -3.000 1.5e-12
ependymoma -1.400 1.7e-03
glioblastoma -2.000 4.0e-10
group 3 medulloblastoma -1.500 2.1e-02
lung adenocarcinoma 1.100 3.4e-06
malignant mesothelioma 1.100 7.9e-05
medulloblastoma, large-cell -1.900 2.1e-05
oligodendroglioma -1.100 3.1e-02
osteosarcoma -2.459 1.4e-08
primitive neuroectodermal tumor -2.100 1.5e-04
psoriasis -1.600 2.1e-04
subependymal giant cell astrocytoma -1.461 4.8e-02
tuberculosis 1.700 4.8e-08

Gene RIF (2)

AA Sequence

MASLDLPYRCPRCGEHKRFRSLSSLRAHLEYSHTYETLYILSKTNSICDGAAAAAAAAAAASGFPLAPEP      1 - 70
AALLAVPGARREVFESTSFQGKEQAAGPSPAAPHLLHHHHHHAPLAHFPGDLVPASLPCEELAEPGLVPA     71 - 140
AAARYALREIEIPLGELFARKSVASSACSTPPPGPGPGPCPGPASASPASPSPADVAYEEGLARLKIRAL    141 - 210
EKLEVDRRLERLSEEVEQKIAGQVGRLQAELERKAAELETARQESARLGREKEELEERASELSRQVDVSV    211 - 280
ELLASLKQDLVHKEQELSRKQQEVVQIDQFLKETAAREASAKLRLQQFIEELLERADRAERQLQVISSSC    281 - 350
GSTPSASLGRGGGGGGAGPNARGPGRMREHHVGPAVPNTYAVSRHGSSPSTGASSRVPAASQSSGCYDSD    351 - 420
SLELPRPEEGAPEDSGPGGLGTRAQAANGGSERSQPPRSSGLRRQAIQNWQRRPRRHSTEGEEGDVSDVG    421 - 490
SRTTESEAEGPLDAPRPGPAMAGPLSSCRLSARPEGGSGRGRRAERVSPSRSNEVISPEILKMRAALFCI    491 - 560
FTYLDTRTLLHAAEVCRDWRFVARHPAVWTRVLLENARVCSKFLAMLAQWCTQAHSLTLQNLKPRQRGKK    561 - 630
ESKEEYARSTRGCLEAGLESLLKAAGGNLLILRISHCPNILTDRSLWLASCYCRALQAVTYRSATDPVGH    631 - 700
EVIWALGAGCREIVSLQVAPLHPCQQPTRFSNRCLQMIGRCWPHLRALGVGGAGCGVQGLASLARNCMRL    701 - 770
QVLELDHVSEITQEVAAEVCREGLKGLEMLVLTATPVTPKALLHFNSICRNLKSIVVQIGIADYFKEPSS    771 - 840
PEAQKLFEDMVTKLQALRRRPGFSKILHIKVEGGC                                       841 - 875
//

Text Mined References (10)

PMID Year Title