Property Summary

NCBI Gene PubMed Count 25
PubMed Score 9.95
PubTator Score 10.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
posterior fossa group B ependymoma 1.300 1.9e-05
glioblastoma 1.200 1.1e-05
group 3 medulloblastoma 1.100 1.9e-03
acute myeloid leukemia -2.000 4.7e-02
ovarian cancer 1.300 1.1e-04

Gene RIF (8)

PMID Text
24704453 results define the impact of alternative splicing on Fbx4 function, and suggest that the attenuated cyclin D1 degradation by these novel Fbx4 isoforms provides a new insight for aberrant cyclin D1 expression in human cancers.
24019069 The FBXO4 I377M mutant exhibits impaired cyclin D1 recruitment and ubiquitylation.
21242966 14-3-3varepsilon binds to Ser12-phosphorylated Fbx4 to mediate dimerization and function.
20181953 Biochemical studies indicate that both the N-terminal domain and a loop connecting the linker and C-terminal domain of Fbx4 are critical for the dimerization and activation of the protein.
20159592 results reveal an atypical small GTPase domain within Fbx4 as a substrate-binding motif for SCF(Fbx4) and uncover a mechanism for selective ubiquitination and degradation of TRF1 in telomere homeostasis control
18598945 Mutations in Fbx4 inhibit dimerization of the SCF(Fbx4) ligase and contribute to cyclin D1 overexpression in human cancer.
17081987 SCF(FBX4-alphaB crystallin) is an E3 ubiquitin ligase that promotes ubiquitin-dependent degradation of Thr286-phosphorylated cyclin D1.
16275645 Fbx4 is a central regulator of Pin2/TRF1 protein abundance and alterations in the stability of Pin2/TRF1 can have a dramatic impact on telomere length

AA Sequence

MAGSEPRSGTNSPPPPFSDWGRLEAAILSGWKTFWQSVSKERVARTTSREEVDEAASTLTRLPIDVQLYI      1 - 70
LSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPDLEILKKPISEVTDGAFFDYM     71 - 140
AVYRMCCPYTRRASKSSRPMYGAVTSFLHSLIIQNEPRFAMFGPGLEELNTSLVLSLMSSEELCPTAGLP    141 - 210
QRQIDGIGSGVNFQLNNQHKFNILILYSTTRKERDRAREEHTSAVNKMFSRHNEGDDQQGSRYSVIPQIQ    211 - 280
KVCEVVDGFIYVANAEAHKRHEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHL    281 - 350
NLLNHPWLVQDTEAETLTGFLNGIEWILEEVESKRAR                                     351 - 387
//

Text Mined References (29)

PMID Year Title
24704453 2014 Alternative splicing variants of human Fbx4 disturb cyclin D1 proteolysis in human cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24019069 2013 The FBXO4 tumor suppressor functions as a barrier to BRAFV600E-dependent metastatic melanoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23108047 2012 FBXW7-mediated degradation of CCDC6 is impaired by ATM during DNA damage response in lung cancer cells.
21378169 2011 A Competitive binding mechanism between Skp1 and exportin 1 (CRM1) controls the localization of a subset of F-box proteins.
21242966 2011 Phosphorylation-dependent regulation of SCF(Fbx4) dimerization and activity involves a novel component, 14-3-3?.
20181953 2010 Structural basis of dimerization-dependent ubiquitination by the SCF(Fbx4) ubiquitin ligase.
20159592 2010 Structural basis of selective ubiquitination of TRF1 by SCFFbx4.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19487455 2009 GNL3L stabilizes the TRF1 complex and promotes mitotic transition.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18598945 2008 Mutations in Fbx4 inhibit dimerization of the SCF(Fbx4) ligase and contribute to cyclin D1 overexpression in human cancer.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081987 2006 Phosphorylation-dependent ubiquitination of cyclin D1 by the SCF(FBX4-alphaB crystallin) complex.
16581786 2006 The ETS protein MEF is regulated by phosphorylation-dependent proteolysis via the protein-ubiquitin ligase SCFSkp2.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16278047 2006 Characterization of FBX25, encoding a novel brain-expressed F-box protein.
16275645 2006 The F-box protein FBX4 targets PIN2/TRF1 for ubiquitin-mediated degradation and regulates telomere maintenance.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10828603 2000 Five human genes encoding F-box proteins: chromosome mapping and analysis in human tumors.
10531037 1999 A family of mammalian F-box proteins.
10531035 1999 Identification of a family of human F-box proteins.