Property Summary

NCBI Gene PubMed Count 43
PubMed Score 291.02
PubTator Score 120.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
astrocytic glioma 1.500 4.3e-02
oligodendroglioma -1.400 3.9e-02
glioblastoma multiforme 1.200 6.6e-09
osteosarcoma 1.344 2.6e-02
group 4 medulloblastoma -2.300 8.4e-04
non diabetic and post-ischemic heart fai... 1.300 1.5e-02
atypical teratoid / rhabdoid tumor -2.400 6.3e-06
medulloblastoma, large-cell -2.600 6.5e-03
primitive neuroectodermal tumor -1.500 4.3e-02
Duchenne muscular dystrophy -1.382 1.1e-05
autosomal dominant Emery-Dreifuss muscul... -1.128 2.6e-03
acute quadriplegic myopathy 1.111 5.9e-03
primary pancreatic ductal adenocarcinoma 2.261 4.4e-03
non-small cell lung cancer 2.729 5.3e-31
intraductal papillary-mucinous adenoma (... 2.800 1.6e-03
intraductal papillary-mucinous carcinoma... 4.400 3.9e-04
pancreatic cancer 2.200 8.4e-03
breast carcinoma -1.400 7.9e-04
cystic fibrosis 1.300 1.4e-02
lung adenocarcinoma 1.500 6.3e-09
subependymal giant cell astrocytoma 3.961 2.2e-03
invasive ductal carcinoma 1.355 9.4e-03
psoriasis -1.600 1.6e-10
Breast cancer -2.100 2.9e-10
spina bifida -2.190 4.3e-02
Alzheimer's disease 1.100 1.8e-02
Pick disease 1.700 2.9e-05
gastric carcinoma 1.900 2.5e-02
ulcerative colitis -1.300 6.9e-03
ovarian cancer 2.500 1.7e-04
pituitary cancer -3.000 1.6e-06

 MGI Phenotype (1)

Gene RIF (37)

PMID Text
26768247 Our data suggest that FBXO32 is a candidate gene for recessive familial dilated cardiomyopathy. Acting as a cardiac ubiquitin ligase, mutated FBXO32 could perturb the degradation of target proteins in the ubiquitin proteasome system.
26753747 Our results indicate that abnormal SCF activity with subsequent impairment of the autophagic flux due to a novel FBXO32 mutation is implicated in the pathogenesis of Dilated cardiomyopathy .
26048142 Expression of USP19 correlates with that of MuRF1 and MAFbx/atrogin-1 in skeletal muscles
25944903 FBXO32 targets Lys-326 of c-Myc to form polyubiquitin chains, resulting in inhibition of cell proliferation.
25876656 Vitamin D3 might have an inhibitory effect on the expression of MAFbx and MuRF1 in skeletal muscle.
25760630 Atrogin-1 expression tended to be increased in the skeletal muscle of patients with malignant disease even before cancer related cachexia weight loss.
25096180 both MuRF1 and MAFbx are enriched in skeletal, cardiac, and smooth muscle--REVIEW
24798237 FBXO32 methylation status and protein expression were independently associated with survival in ESCC. FBXO32 may be a functional tumor suppressor. Its inactivation through promoter methylation could play an important role in ESCC carcinogenesis.
24650875 MAFbx not only regulates protein degradation, but also reduces protein synthesis, exerting a dual role in regulating cardiac mass and preventing from cardiac hypertrophy.
24458747 In conclusion, atrogin-1, MuRF1, FOXO1/3A, and eIF3-f mRNA, and protein levels, are differentially regulated by exercise contraction mode but not WPH supplementation combined with hypertrophy-inducing training.
24213577 EZH2 is a key factor in the proliferation and survival of PAX3-FOXO1 alveolar RMS cells working, at least in part, by repressing FBXO32
23844868 Quadriceps muscle atrogin-1 levels were lower in COPD patients than controls, but similar in patients with a low and normal fat-free mass index. Atrogin1 levels were not associated with quadriceps fiber cross-sectional area or strength in patients.
23816995 ATROGIN1 gene expression is increased in patients with severe burn injury.
22815045 Data suggest expression of atrogin-1 and MuRF-1 (muscle-specific RING finger protein 1) play role in aging-related decrease in muscle mass (i.e., sarcopenia); up-regulation of atrogin-1/MuRF-1 has potential to prevent/reverse sarcopenia. [REVIEW]
22590725 In a transgenic mouse model of autoimmune myositis, cellular inflammation is associated with FOXO3A translocation and Atrogin-1 induction.
22476926 Resistance exercise resulted in a significant downregulation of MSTN and FBXO32 mRNA expression and a significant upregulation in FSTL3 and SMURF1 mRNA expression, and carbohydrate and protein feeding have little influence on the these markers expression.
22311109 Cardiac and vascular atrogin-1 mRNA expression is not associated with dexamethasone efficacy in the monocrotaline model of pulmonary hypertension.
22249105 MAFbx contains two functional nuclear localization signals (NLS). Mutation or deletion of only one NLS induced cytoplasmic localization of MAFbx.
22127230 investigation of factors regulating expression of two ubiquitin ligases (MAFbx and MURF1) in skeletal muscle (i.e., vastus lateralis): effects of resistance exercise and anabolic dietary supplement (i.e., branched-chain amino acids)
21725612 SerpinB5 interacts with KHDRBS3 and FBXO32, and KHDRBS3 can interact with FBXO32 mRNA.
21304964 11beta-HSD1 controls glucocorticoid-induced protein degradation in human and murine skeletal muscle via regulation of the E3 ubiquitin ligases Atrogin-1 and MuRF-1.
20833824 atrophic AKT-FOXO signaling play major roles in eliciting pathological changes associated with diaphragm disuse.
20065949 The novel tumor suppressor FBXO32 is epigenetically silenced in ovarian cancer cell lines with disrupted TGF-beta/SMAD4 signaling, and FBXO32 methylation status predicts survival in patients with ovarian cancer.
19859778 Reduced expression of MuRF1 and MAFbx in the myocardium might permit hypertrophy characteristic of the early post-infarction remodeling phase.
19850579 atrogin-1 specifically targets truncated M7t-cMyBP-C, but not WT-cMyBP-C, for proteasomal degradation and that MuRF1 indirectly reduces cMyBP-C levels by regulating the transcription of myosin heavy chain.
19453261 Observational study of gene-disease association. (HuGE Navigator)
18681786 Review discusses findings implicating atrogin-1, a gene required for muscle atrophy, in the pathophysiology of statin-induced muscle injury.
18599544 Testosterone represses MAFbx expression via interactions of the AR with Oct-1.
17992259 atrogin-1 may be a critical mediator of the muscle damage induced by statins.
17977773 Results showed upregulation of MuRf1 and MAFbx in atrophies muscle and support their role as regulatory peptides in various conditions which lead to muscle atrophy.
17971512 MuRF-1 and MAFbx, are differently affected by the exercise as well as by repeated exercise
17901116 Expression of mRNA for MuRF-1 increased approximately 3-fold at 10 days without changes in MAFbx or tripeptidyl peptidase II mRNA, but all decreased between 10 and 21 days of muscle disuse.
17609255 We conclude that smoking impairs the muscle protein synthesis process and increases the expression of genes associated with impaired muscle maintenance; smoking therefore likely increases the risk of sarcopenia.
17519359 CSRP3, MUSTN1, SIX1, and FBXO32 expression changes in response to lengthening and shortening contractions in human muscle
17478621 Atrogin-1 mRNA expression was significantly increased in quadriceps of patients with COPD; transcriptional regulation of atrogin-1 and MuRF1 may occur via FoxO-1, but independently of AKT
16868939 results suggest that Cbl-b- or atrogin-1-mediated ubiquitination plays an important role in unloading-induced muscle atrophy, and that unloading stress may preferentially inhibit transcriptional responses in skeletal muscle
16507768 Human skeletal muscle atrophy in the amyotrophic lateral sclerosis shows an increase in atrogin-1 & a decrease in Akt. The transcriptional regulation of human atrogin-1 may be controlled by an Akt-mediated transcription factor other than FKHR.

AA Sequence

MPFLGQDWRSPGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLN      1 - 70
SKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGI     71 - 140
AQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQL    141 - 210
NNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIR    211 - 280
KRLILSDKGQLDWKKMYFKLVRCYPRKEQYGDTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFI    281 - 350
NLFKF                                                                     351 - 355
//

Text Mined References (45)

PMID Year Title
26768247 2016 A substitution mutation in cardiac ubiquitin ligase, FBXO32, is associated with an autosomal recessive form of dilated cardiomyopathy.
26753747 2016 FBXO32, encoding a member of the SCF complex, is mutated in dilated cardiomyopathy.
26048142 2015 Inactivation of the ubiquitin-specific protease 19 deubiquitinating enzyme protects against muscle wasting.
25944903 2015 FBXO32 Targets c-Myc for Proteasomal Degradation and Inhibits c-Myc Activity.
25876656 2015 1?,25(OH)2D3 downregulates gene expression levels of muscle ubiquitin ligases MAFbx and MuRF1 in human myotubes.
25760630 2015 Muscle-specific E3 ubiquitin ligases are involved in muscle atrophy of cancer cachexia: an in vitro and in vivo study.
25096180 2014 Skeletal muscle atrophy and the E3 ubiquitin ligases MuRF1 and MAFbx/atrogin-1.
24798237 2014 Aberrant methylation and decreased expression of the TGF-?/Smad target gene FBXO32 in esophageal squamous cell carcinoma.
24650875 2014 MAFbx/Atrogin-1 is required for atrophic remodeling of the unloaded heart.
24458747 2014 Influence of divergent exercise contraction mode and whey protein supplementation on atrogin-1, MuRF1, and FOXO1/3A in human skeletal muscle.
24213577 2014 The Polycomb group (PcG) protein EZH2 supports the survival of PAX3-FOXO1 alveolar rhabdomyosarcoma by repressing FBXO32 (Atrogin1/MAFbx).
23844868 2013 MuRF-1 and atrogin-1 protein expression and quadriceps fiber size and muscle mass in stable patients with COPD.
23816995 Increased expression of atrogenes and TWEAK family members after severe burn injury in nonburned human skeletal muscle.
22815045 2013 Atrogin-1, MuRF-1, and sarcopenia.
22590725 2012 Foxo/atrogin induction in human and experimental myositis.
22476926 2013 Effects of pre-exercise feeding on serum hormone concentrations and biomarkers of myostatin and ubiquitin proteasome pathway activity.
22311109 2012 Cardiac and vascular atrogin-1 mRNA expression is not associated with dexamethasone efficacy in the monocrotaline model of pulmonary hypertension.
22249105 2012 Identification of essential sequences for cellular localization in the muscle-specific ubiquitin E3 ligase MAFbx/Atrogin 1.
22127230 2012 Intake of branched-chain amino acids influences the levels of MAFbx mRNA and MuRF-1 total protein in resting and exercising human muscle.
21725612 2011 SerpinB5 interacts with KHDRBS3 and FBXO32 in gastric cancer cells.
21304964 2011 Skeletal muscle 11beta-HSD1 controls glucocorticoid-induced proteolysis and expression of E3 ubiquitin ligases atrogin-1 and MuRF-1.
20833824 2011 Increased proteolysis, myosin depletion, and atrophic AKT-FOXO signaling in human diaphragm disuse.
20065949 2010 Promoter hypermethylation of FBXO32, a novel TGF-beta/SMAD4 target gene and tumor suppressor, is associated with poor prognosis in human ovarian cancer.
19859778 2010 Depressed expression of MuRF1 and MAFbx in areas remote of recent myocardial infarction: a mechanism contributing to myocardial remodeling?
19850579 2010 Atrogin-1 and MuRF1 regulate cardiac MyBP-C levels via different mechanisms.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
18681786 2008 Molecular basis for statin-induced muscle toxicity: implications and possibilities.
18599544 2008 Expression of the muscle atrophy factor muscle atrophy F-box is suppressed by testosterone.
18354498 2008 The initiation factor eIF3-f is a major target for atrogin1/MAFbx function in skeletal muscle atrophy.
17992259 2007 The muscle-specific ubiquitin ligase atrogin-1/MAFbx mediates statin-induced muscle toxicity.
17977773 2008 Ubiquitin ligases MuRF1 and MAFbx in human skeletal muscle atrophy.
17971512 2008 Repeated resistance exercise training induces different changes in mRNA expression of MAFbx and MuRF-1 in human skeletal muscle.
17901116 2007 The temporal responses of protein synthesis, gene expression and cell signalling in human quadriceps muscle and patellar tendon to disuse.
17609255 2007 Smoking impairs muscle protein synthesis and increases the expression of myostatin and MAFbx in muscle.
17519359 2007 Gene expression responses over 24 h to lengthening and shortening contractions in human muscle: major changes in CSRP3, MUSTN1, SIX1, and FBXO32.
17478621 2007 Muscle atrophy and hypertrophy signaling in patients with chronic obstructive pulmonary disease.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16868939 2006 Ubiquitin ligase gene expression in healthy volunteers with 20-day bedrest.
16507768 2006 Human skeletal muscle atrophy in amyotrophic lateral sclerosis reveals a reduction in Akt and an increase in atrogin-1.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15531760 2005 Degradation of MyoD mediated by the SCF (MAFbx) ubiquitin ligase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11717410 2001 Atrogin-1, a muscle-specific F-box protein highly expressed during muscle atrophy.
11679633 2001 Identification of ubiquitin ligases required for skeletal muscle atrophy.