Property Summary

NCBI Gene PubMed Count 20
PubMed Score 3.32
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.100 1.3e-02
atypical teratoid / rhabdoid tumor 1.500 4.7e-08
chronic rhinosinusitis -1.146 1.9e-02
group 4 medulloblastoma 1.200 1.5e-02
hepatocellular carcinoma 1.100 1.8e-04
intraductal papillary-mucinous adenoma (... 1.100 3.6e-02
lung cancer 1.700 2.2e-04
medulloblastoma, large-cell 1.100 1.9e-05
nasopharyngeal carcinoma 1.200 1.4e-04
non-small cell lung cancer 1.133 4.7e-17
ovarian cancer -2.600 1.9e-13
primitive neuroectodermal tumor 1.200 5.4e-05
psoriasis 1.100 8.7e-03

Gene RIF (6)

AA Sequence

MEPVGCCGECRGSSVDPRSTFVLSNLAEVVERVLTFLPAKALLRVACVCRLWRECVRRVLRTHRSVTWIS      1 - 70
AGLAEAGHLEGHCLVRVVAEELENVRILPHTVLYMADSETFISLEECRGHKRARKRTSMETALALEKLFP     71 - 140
KQCQVLGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLFPQIEGIKIQPFHFIKDPKNLTLERHQLTEVG    141 - 210
LLDNPELRVVLVFGYNCCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSF    211 - 280
SGHRIQSATVLLNEDVSDEKTAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFP    281 - 350
SVPLFGFFGNGEIGCDRIVTGNFILRKCNEVKDDDLFHSYTTIMALIHLGSSK                     351 - 403
//

Text Mined References (28)

PMID Year Title