Property Summary

NCBI Gene PubMed Count 21
PubMed Score 16.08
PubTator Score 11.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Fanconi's anemia 50 3.304 1.7
Cockayne syndrome 54 3.093 1.5

Expression

Gene RIF (12)

PMID Text
25585578 FBH1 acts as a negative regulator of RAD51 function in human cells
24108124 FBH1 restraining RAD51 DNA binding under unperturbed growth conditions to prevent unwanted or unscheduled DNA recombination.
23677613 The study reports a mechanism that controls the degradation of FBH1 after DNA damage.
23466708 FBH1 inactivation appears to contribute to oncogenic transformation by allowing survival of cells undergoing replicative stress due to external factors such as UV irradiation.
23393192 Ubiquitylation affects FBH1 interaction with the RAD51 nucleoprotein filament, but not its translocase and helicase activities.
23361013 FBH1 helicase activity is required to eliminate cells with excessive replication stress through the generation of MUS81-induced DNA double-strand breaks.
23319600 FBH1 helicase activity is required for the efficient induction of DSBs and apoptosis specifically in response to DNA replication stress.
19736316 Data show that the human Fbh1 (hFbh1) helicase accumulates at sites of DNA damage or replication stress in a manner dependent fully on its helicase activity and partially on its conserved F box.
18187620 Knockdown of F-box protein, helicase 18 (FBXO18) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17724085 These findings suggest that the hFBH1 helicase is a functional human orthologue of budding yeast Srs2 that also possesses self-regulation properties necessary to execute its recombination functions.
16385451 Observational study of gene-disease association. (HuGE Navigator)
11956208 hFBH1 exhibited DNA-dependent ATPase and DNA unwinding activities that displace duplex DNA in the 3' to 5' direction.

AA Sequence

MRRFKRKHLTAIDCQHLARSHLAVTQPFGQRWTNRDPNHGLYPKPRTKRGSRGQGSQRCIPEFFLAGKQP      1 - 70
CTNDMAKSNSVGQDSCQDSEGDMIFPAESSCALPQEGSAGPGSPGSAPPSRKRSWSSEEESNQATGTSRW     71 - 140
DGVSKKAPRHHLSVPCTRPREARQEAEDSTSRLSAESGETDQDAGDVGPDPIPDSYYGLLGTLPCQEALS    141 - 210
HICSLPSEVLRHVFAFLPVEDLYWNLSLVCHLWREIISDPLFIPWKKLYHRYLMNEEQAVSKVDGILSNC    211 - 280
GIEKESDLCVLNLIRYTATTKCSPSVDPERVLWSLRDHPLLPEAEACVRQHLPDLYAAAGGVNIWALVAA    281 - 350
VVLLSSSVNDIQRLLFCLRRPSSTVTMPDVTETLYCIAVLLYAMREKGINISNRIHYNIFYCLYLQENSC    351 - 420
TQATKVKEEPSVWPGKKTIQLTHEQQLILNHKMEPLQVVKIMAFAGTGKTSTLVKYAEKWSQSRFLYVTF    421 - 490
NKSIAKQAERVFPSNVICKTFHSMAYGHIGRKYQSKKKLNLFKLTPFMVNSVLAEGKGGFIRAKLVCKTL    491 - 560
ENFFASADEELTIDHVPIWCKNSQGQRVMVEQSEKLNGVLEASRLWDNMRKLGECTEEAHQMTHDGYLKL    561 - 630
WQLSKPSLASFDAIFVDEAQDCTPAIMNIVLSQPCGKIFVGDPHQQIYTFRGAVNALFTVPHTHVFYLTQ    631 - 700
SFRFGVEIAYVGATILDVCKRVRKKTLVGGNHQSGIRGDAKGQVALLSRTNANVFDEAVRVTEGEFPSRI    701 - 770
HLIGGIKSFGLDRIIDIWILLQPEEERRKQNLVIKDKFIRRWVHKEGFSGFKRYVTAAEDKELEAKIAVV    771 - 840
EKYNIRIPELVQRIEKCHIEDLDFAEYILGTVHKAKGLEFDTVHVLDDFVKVPCARHNLPQLPHFRVESF    841 - 910
SEDEWNLLYVAVTRAKKRLIMTKSLENILTLAGEYFLQAELTSNVLKTGVVRCCVGQCNNAIPVDTVLTM    911 - 980
KKLPITYSNRKENKGGYLCHSCAEQRIGPLAFLTASPEQVRAMERTVENIVLPRHEALLFLVF           981 - 1043
//

Text Mined References (24)

PMID Year Title
25772361 2015 FBH1 Catalyzes Regression of Stalled Replication Forks.
25585578 2015 FBH1 influences DNA replication fork stability and homologous recombination through ubiquitylation of RAD51.
24108124 2013 FBH1 helicase disrupts RAD51 filaments in vitro and modulates homologous recombination in mammalian cells.
23954233 2013 Cysteine mutations cause defective tyrosine phosphorylation in MEGF10 myopathy.
23677613 2013 The helicase FBH1 is tightly regulated by PCNA via CRL4(Cdt2)-mediated proteolysis in human cells.
23466708 2013 FBH1 protects melanocytes from transformation and is deregulated in melanomas.
23393192 2013 Single-molecule sorting reveals how ubiquitylation affects substrate recognition and activities of FBH1 helicase.
23361013 2013 FBH1 co-operates with MUS81 in inducing DNA double-strand breaks and cell death following replication stress.
23319600 2013 FBH1 promotes DNA double-strand breakage and apoptosis in response to DNA replication stress.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20453838 2010 Genome-wide association study identifies five new breast cancer susceptibility loci.
19736316 2009 Human Fbh1 helicase contributes to genome maintenance via pro- and anti-recombinase activities.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17724085 2007 The human F-Box DNA helicase FBH1 faces Saccharomyces cerevisiae Srs2 and postreplication repair pathway roles.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11956208 2002 The novel human DNA helicase hFBH1 is an F-box protein.
10531037 1999 A family of mammalian F-box proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.