| Tdark | F-box only protein 16 |
Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation.
This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbx class. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]
This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbx class. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| lung carcinoma | 2844 | 2.4e-28 |
| ulcerative colitis | 2087 | 1.2e-05 |
| pilocytic astrocytoma | 3086 | 3.2e-05 |
| osteosarcoma | 7933 | 1.5e-04 |
| intraductal papillary-mucinous adenoma (IPMA) | 2956 | 1.7e-04 |
| adult high grade glioma | 2148 | 1.8e-03 |
| active Crohn's disease | 918 | 3.4e-03 |
| astrocytic glioma | 2241 | 1.0e-02 |
| invasive ductal carcinoma | 2950 | 1.9e-02 |
| Disease | log2 FC | p |
|---|---|---|
| astrocytic glioma | -1.400 | 1.0e-02 |
| osteosarcoma | -1.466 | 1.5e-04 |
| intraductal papillary-mucinous adenoma (... | 1.400 | 1.7e-04 |
| active Crohn's disease | 1.421 | 3.4e-03 |
| adult high grade glioma | -1.200 | 1.8e-03 |
| pilocytic astrocytoma | -1.100 | 3.2e-05 |
| lung carcinoma | 3.200 | 2.4e-28 |
| invasive ductal carcinoma | 1.200 | 1.9e-02 |
| ulcerative colitis | 1.200 | 1.2e-05 |
| PMID | Text | |
|---|---|---|
| 12243353 | FBXO16 was localized to the human chromosome 8p12. The FBXO16 gene consisted of 9 exons that spanned 67,816 bp of human genomic DNA |
MMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQ 1 - 70 KFCCRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYI 71 - 140 NFSPTPFEQGIWKKHYIQMVKELHITKPKTPPKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRKKNN 141 - 210 SGEKALPPWRSSDKHPTDIIRFNYLDNRDPMETVQQGRRKRNQMTPDFSRQSHDKKNKLQDRTRLRKAQS 211 - 280 MMSRRNPFPLCP 281 - 292 //
| PMID | Year | Title | |
|---|---|---|---|
| 16712791 | 2006 | Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags. | |
| 16421571 | 2006 | DNA sequence and analysis of human chromosome 8. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12243353 | 2002 | cDNA cloning and expression analysis of a novel human F-box only protein. | |
| 10531035 | 1999 | Identification of a family of human F-box proteins. |
