Property Summary

NCBI Gene PubMed Count 31
PubMed Score 28.92
PubTator Score 22.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.100 4.3e-02
psoriasis -1.200 4.1e-04
osteosarcoma -1.923 7.6e-06
tuberculosis and treatment for 6 months 1.200 7.3e-03
pancreatic ductal adenocarcinoma liver m... 1.389 5.6e-03
non-small cell lung cancer 1.120 1.7e-14
lung cancer -1.300 6.7e-03
Breast cancer 2.700 3.8e-02
group 3 medulloblastoma 1.400 8.4e-04
non primary Sjogren syndrome sicca -1.200 1.8e-02
ovarian cancer -2.000 8.4e-11

 GWAS Trait (1)

Gene RIF (19)

PMID Text
26187670 siRNA-mediated knockdown of FBXO11 facilitated HIF-1alpha expression in various cancer cells and HIF-1alpha-driven gene expressions, but the FBXO10 knockdown did not.
26059563 UBR3/6 regulate cardiomyocyte Nav 1.5 channel protein levels via the ubiquitin-proteasome pathway.
25867061 FBXO11 is a direct target of miR-621 in breast cancer cells.
25589783 Our results identify FBXO11 as a novel miR-21 target gene, and demonstrate that the oncogenic miRNA miR-21 decreases the expression of FBXO11, which normally acts as a tumor suppressor, and thereby promotes tumorigenesis.
25203322 The PKD1-FBXO11-SNAIL axis is a mechanism of posttranslational regulation of epithelial-mesenchymal transition and cancer metastasis.
24349473 study defined eight additional recurrently mutated genes in SMZL; these genes are CREBBP, CBFA2T3, AMOTL1, FAT4, FBXO11, PLA2G4D, TRRAP and USH2A.
23892434 TGF-beta signaling promotes exit from the cell cycle and cellular migration through cullin cross-regulation: SCF-FBXO11 turns off CRL4-Cdt2.
23478445 Migration of epithelial cells is stimulated by CRL1(FBXO11)-mediated downregulation of Cdt2 and the consequent stabilization of Set8.
23478441 The functional interaction between FBXO11 and CDT2 is evolutionary conserved from worms to humans and plays an important role in regulating the timing of cell-cycle exit.
23110726 Depletion of F-box protein 11 (FBXO11) by siRNA enhances HIV-1 Tat activation of HIV-1 LTR, which is not the results of increased Tat expression and release of CDK9/CCNT1 from 7SK snRNP, and activation of NF-kappaB
22113614 A molecular mechanism controlling BCL6 stability--mutations and deletions in FBXO11 contribute to lymphomagenesis through BCL6 stabilization
21293382 these data provide strong evidence for FBXO11 as a susceptibility gene for severe OM.
20646433 FBXO11 has a lower expression in skin lesion tissues than in normal tissues from vitiligo patients.
20514423 Results support the notion that FBXO11 plays an important role in regulating proliferation and apoptosis of melanocytes, and functional export of tyrosinase from ER in vitiligo melanocytes.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17098746 FBXO11 promotes the Neddylation (NEDD8) of p53 and inhibits its transcriptional activity
16847180 Observational study of gene-disease association. (HuGE Navigator)
16847180 The FBXO11 gene is the human homologue of the gene mutated in the novel deaf mouse mutant jeff (Jf), a single gene model of otitis media. FBXO11 gene for association with chronic otitis media with effusion.
16487488 A type II protein arginine methyltransferase that forms asymmetric dimethylarginine modifications in proteins.

AA Sequence

MNSVRAANRRPRRVSRPRPVQQQQQQPPQQPPPQPPQQQPPQQQPPPPPQQQQQQQPPPPPPPPPPLPQE      1 - 70
RNNVGERDDDVPADMVAEESGPGAQNSPYQLRRKTLLPKRTACPTKNSMEGASTSTTENFGHRAKRARVS     71 - 140
GKSQDLSAAPAEQYLQEKLPDEVVLKIFSYLLEQDLCRAACVCKRFSELANDPILWKRLYMEVFEYTRPM    141 - 210
MHPEPGKFYQINPEEYEHPNPWKESFQQLYKGAHVKPGFAEHFYSNPARYKGRENMLYYDTIEDALGGVQ    211 - 280
EAHFDGLIFVHSGIYTDEWIYIESPITMIGAAPGKVADKVIIENTRDSTFVFMEGSEDAYVGYMTIRFNP    281 - 350
DDKSAQHHNAHHCLEITVNCSPIIDHCIIRSTCTVGSAVCVSGQGACPTIKHCNISDCENVGLYITDHAQ    351 - 420
GIYEDNEISNNALAGIWVKNHGNPIIRRNHIHHGRDVGVFTFDHGMGYFESCNIHRNRIAGFEVKAYANP    421 - 490
TVVRCEIHHGQTGGIYVHEKGRGQFIENKIYANNFAGVWITSNSDPTIRGNSIFNGNQGGVYIFGDGRGL    491 - 560
IEGNDIYGNALAGIQIRTNSCPIVRHNKIHDGQHGGIYVHEKGQGVIEENEVYSNTLAGVWVTTGSTPVL    561 - 630
RRNRIHSGKQVGVYFYDNGHGVLEDNDIYNHMYSGVQIRTGSNPKIRRNKIWGGQNGGILVYNSGLGCIE    631 - 700
DNEIFDNAMAGVWIKTDSNPTLRRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPILRK    701 - 770
NRIFDGFAAGIEITNHATATLEGNQIFNNRFGGLFLASGVNVTMKDNKIMNNQDAIEKAVSRGQCLYKIS    771 - 840
SYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTD    841 - 910
TLYDSAPPIESNTLQHN                                                         911 - 927
//

Text Mined References (36)

PMID Year Title
26187670 2015 FBXO11 represses cellular response to hypoxia by destabilizing hypoxia-inducible factor-1? mRNA.
26059563 2015 Cardiac Nav 1.5 is modulated by ubiquitin protein ligase E3 component n-recognin UBR3 and 6.
25867061 2016 MiRNA-621 sensitizes breast cancer to chemotherapy by suppressing FBXO11 and enhancing p53 activity.
25589783 2015 The oncogenic microRNA-21 inhibits the tumor suppressive activity of FBXO11 to promote tumorigenesis.
25416956 2014 A proteome-scale map of the human interactome network.
25203322 2014 PKD1 phosphorylation-dependent degradation of SNAIL by SCF-FBXO11 regulates epithelial-mesenchymal transition and metastasis.
24968003 2014 BLMP-1/Blimp-1 regulates the spatiotemporal cell migration pattern in C. elegans.
24613396 2014 DRE-1/FBXO11-dependent degradation of BLMP-1/BLIMP-1 governs C. elegans developmental timing and maturation.
24349473 2013 Whole exome sequencing identifies novel recurrently mutated genes in patients with splenic marginal zone lymphoma.
23894747 2013 A comprehensive family-based replication study of schizophrenia genes.
23892434 2013 Regulation of TGF-? signaling, exit from the cell cycle, and cellular migration through cullin cross-regulation: SCF-FBXO11 turns off CRL4-Cdt2.
23478445 2013 CRL1-FBXO11 promotes Cdt2 ubiquitylation and degradation and regulates Pr-Set7/Set8-mediated cellular migration.
23478441 2013 Regulation of the CRL4(Cdt2) ubiquitin ligase and cell-cycle exit by the SCF(Fbxo11) ubiquitin ligase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22632967 2012 Cyclin F-mediated degradation of ribonucleotide reductase M2 controls genome integrity and DNA repair.
22113614 2012 FBXO11 targets BCL6 for degradation and is inactivated in diffuse large B-cell lymphomas.
21293382 2011 FBXO11, a regulator of the TGF? pathway, is associated with severe otitis media in Western Australian children.
20646433 2010 [Expression of InnVit/FBXO11 in vitiligo and its role in tyrosinase export from endoplasmic reticulum].
20514423 2010 The role of VIT1/FBXO11 in the regulation of apoptosis and tyrosinase export from endoplasmic reticulum in cultured melanocytes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19360327 2009 VIT1/FBXO11 knockdown induces morphological alterations and apoptosis in B10BR mouse melanocytes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17642606 VIT1 gene and vitiligo.
17098746 2007 FBXO11 promotes the Neddylation of p53 and inhibits its transcriptional activity.
16847180 2006 Association of the FBXO11 gene with chronic otitis media with effusion and recurrent otitis media: the Minnesota COME/ROM Family Study.
16487488 2006 FBXO11/PRMT9, a new protein arginine methyltransferase, symmetrically dimethylates arginine residues.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11775060 2001 'VIT1', a novel gene associated with vitiligo.
10531037 1999 A family of mammalian F-box proteins.
10531035 1999 Identification of a family of human F-box proteins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.