Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3098 1.5e-13
malignant mesothelioma 3163 1.8e-05
osteosarcoma 7933 2.4e-04
medulloblastoma, large-cell 6234 1.2e-02

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.300 1.8e-05
osteosarcoma -1.140 2.4e-04
medulloblastoma, large-cell 1.100 1.2e-02
Breast cancer 1.400 1.5e-13

Synonym

Accession Q8N531 Q53G43 Q9H5W9 Q9UKC7
Symbols FBL6
FBL6A
PP14630

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 GO Process (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
18426905 Fbl6 regulates Tel/Yan protein stability and allows appropriate spatiotemporal control of gene expression by these repressors.

AA Sequence

MAAPASRQVRRRARAAPRPRSAEDWWWDRLAPRGSGYHLLQSDSMLLVLSEPGPARPRAQRRASRRTPRQ      1 - 70
PPRGPSAAAKPKAGLRSEAAAAPAPAPAPTPTPEEGPDAGWGDRIPLEILVQIFGLLVAADGPMPFLGRA     71 - 140
ARVCRRWQEAASQPALWHTVTLSSPLVGRPAKGGVKAEKKLLASLEWLMPNRFSQLQRLTLIHWKSQVHP    141 - 210
VLKLVGECCPRLTFLKLSGCHGVTADALVMLAKACCQLHSLDLQHSMVESTAVVSFLEEAGSRMRKLWLT    211 - 280
YSSQTTAILGALLGSCCPQLQVLEVSTGINRNSIPLQLPVEALQKGCPQLQVLRLLNLMWLPKPPGRGVA    281 - 350
PGPGFPSLEELCLASSTCNFVSNEVLGRLLHGSPNLRLLDLRGCARITPAGLQDLPCRELEQLHLGLYGT    351 - 420
SDRLTLAKEGSPFLTQKWCHTLRELDLSGQGFSEKDLEQALAAFLSTPGGSHPALCSLNLRGTRVTPSTV    421 - 490
SSVISSCPGLLYLNLESCRCLPRGLKRAYRGLEEVQWCLEQLLTSPSPS                         491 - 539
//

Text Mined References (9)

PMID Year Title
18426905 2008 Downregulation of vertebrate Tel (ETV6) and Drosophila Yan is facilitated by an evolutionarily conserved mechanism of F-box-mediated ubiquitination.
16341674 2005 Transcriptome analysis of human gastric cancer.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10531037 1999 A family of mammalian F-box proteins.
10531035 1999 Identification of a family of human F-box proteins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.