Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3578 1.5e-13
malignant mesothelioma 3232 1.8e-05
osteosarcoma 7950 2.4e-04
medulloblastoma, large-cell 6241 1.2e-02

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 1.400 1.5e-13
malignant mesothelioma 1.300 1.8e-05
medulloblastoma, large-cell 1.100 1.2e-02
osteosarcoma -1.140 2.4e-04

 GO Process (1)

 Compartment GO Term (1)

Gene RIF (1)

AA Sequence

MAAPASRQVRRRARAAPRPRSAEDWWWDRLAPRGSGYHLLQSDSMLLVLSEPGPARPRAQRRASRRTPRQ      1 - 70
PPRGPSAAAKPKAGLRSEAAAAPAPAPAPTPTPEEGPDAGWGDRIPLEILVQIFGLLVAADGPMPFLGRA     71 - 140
ARVCRRWQEAASQPALWHTVTLSSPLVGRPAKGGVKAEKKLLASLEWLMPNRFSQLQRLTLIHWKSQVHP    141 - 210
VLKLVGECCPRLTFLKLSGCHGVTADALVMLAKACCQLHSLDLQHSMVESTAVVSFLEEAGSRMRKLWLT    211 - 280
YSSQTTAILGALLGSCCPQLQVLEVSTGINRNSIPLQLPVEALQKGCPQLQVLRLLNLMWLPKPPGRGVA    281 - 350
PGPGFPSLEELCLASSTCNFVSNEVLGRLLHGSPNLRLLDLRGCARITPAGLQDLPCRELEQLHLGLYGT    351 - 420
SDRLTLAKEGSPFLTQKWCHTLRELDLSGQGFSEKDLEQALAAFLSTPGGSHPALCSLNLRGTRVTPSTV    421 - 490
SSVISSCPGLLYLNLESCRCLPRGLKRAYRGLEEVQWCLEQLLTSPSPS                         491 - 539
//

Text Mined References (9)

PMID Year Title