Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.26
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6P050
Symbols Fbl22

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

 IMPC Phenotype (1)

Protein-protein Interaction (9)

Gene RIF (1)

AA Sequence

MWPLLTMHITQLNRECLLHLFSFLDKDSRKSLARTCSQLHDVFEDPALWSLLHFRSLTELQKDNFLLGPA      1 - 70
LRSLSICWHSSRVQVCSIEDWLKSAFQRSICSRHESLVNDFLLRVCDRLSAVRSPRRREAPAPSSGTPIA     71 - 140
VGPKSPRWGGPDHSEFADLRSGVTGARAAARRGLGSLRAERPSETPPAPGVSWGPPPPGAPVVISVKQEE    141 - 210
GKQGRTGRRSHRAAPPCGFARTRVCPPTFPGADAFPQ                                     211 - 247
//

Text Mined References (12)

PMID Year Title