Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.44
PubTator Score 0.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma 2.957 2.1e-07
atypical teratoid / rhabdoid tumor -1.100 1.4e-03
glioblastoma -1.200 8.3e-04
group 4 medulloblastoma 1.300 4.2e-04
primitive neuroectodermal tumor 1.100 8.3e-03
adult high grade glioma -1.400 2.7e-04
non primary Sjogren syndrome sicca -1.100 2.0e-02
aldosterone-producing adenoma -1.186 5.7e-03
subependymal giant cell astrocytoma -1.151 2.3e-02
spina bifida -1.351 4.6e-02
Pick disease 1.600 2.9e-04
progressive supranuclear palsy 1.400 3.5e-02
Breast cancer 1.500 4.9e-07
ovarian cancer -1.100 4.8e-10
cystic fibrosis and chronic rhinosinusit... 1.077 3.5e-02

 IMPC Phenotype (1)

Gene RIF (3)

PMID Text
25593308 which provides a signal to promote its ubiquitination and proteasomal degradation mediated by FBXL20 and the associated Skp1-Cullin1 complex, leading to inhibition of autophagy and receptor endocytosis
23023584 study concludes FBXL20 plays an essential role in the carcinogenesis of colorectal adenocarcinoma and promotes carcinogenesis through the regulation of the Wnt signaling pathway and caspase activation
19124506 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRRDVNGVTKSRFEMFSNSDEAVINKKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDL      1 - 70
FDFQRDIEGRVVENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKTTDATCTSLSK     71 - 140
FCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLED    141 - 210
EALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEV    211 - 280
ARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGA    281 - 350
CAHDQLEVIELDNCPLITDASLEHLKSCHSLERIELYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPP    351 - 420
SVGGSRQRFCRCCIIL                                                          421 - 436
//

Text Mined References (14)

PMID Year Title
25593308 2015 FBXL20-mediated Vps34 ubiquitination as a p53 controlled checkpoint in regulating autophagy and receptor degradation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23023584 2012 Role of FBXL20 in human colorectal adenocarcinoma.
21399635 2011 Genome-wide association study identifies 12 new susceptibility loci for primary biliary cirrhosis.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18088087 2008 Phosphoproteome of resting human platelets.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.