Property Summary

NCBI Gene PubMed Count 21
PubMed Score 7.93
PubTator Score 15.68

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -1.100 2.7e-06
astrocytic glioma -1.200 6.7e-03
oligodendroglioma -1.400 2.4e-02
glioblastoma -1.500 2.2e-03
medulloblastoma -1.100 7.0e-04
intraductal papillary-mucinous adenoma (... -1.100 1.8e-03
pediatric high grade glioma -1.400 3.5e-05
lung carcinoma 1.600 5.2e-19
Pick disease -1.400 3.5e-04

Gene RIF (7)

PMID Text
26790640 these results uncover a previous unknown network involving FBXL2 and FoxM1 in the regulation of gastric cancer growth.
26037928 FBXL2 recognizes Trp-73 within NALP3 for interaction and targets Lys-689 within NALP3 for ubiquitin ligation and degradation.
23604317 FBXL2 mediates the ubiquitylation and degradation of p85beta on cell membranes.
22455980 These results suggested that the involvement of the reduction of FBL2 level is related to AD progression.
22399757 FBL2 is a novel and dual regulator of amyloid precursor protein (APP) metabolism through FBL2-dependent ubiquitination of APP.
22323446 FBXL2 targets cyclin D2 for ubiquitination and degradation to inhibit leukemic cell proliferation.
22020328 FBXL2 is indispensible regulator of mitosis that serves as a tumor suppressor

AA Sequence

MVFSNNDEGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNFQTDVEGRVVE      1 - 70
NISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSC     71 - 140
VSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHEL    141 - 210
VSLNLQSCSRITDEGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTL    211 - 280
LARNCHELEKMDLEECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDN    281 - 350
CLLITDVALEHLENCRGLERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPTAVAGSGQRLCRCC    351 - 420
VIL                                                                       421 - 423
//

Text Mined References (24)

PMID Year Title
26790640 2016 F-box protein FBXL2 inhibits gastric cancer proliferation by ubiquitin-mediated degradation of forkhead box M1.
26037928 2015 Lipopolysaccharide Primes the NALP3 Inflammasome by Inhibiting Its Ubiquitination and Degradation Mediated by the SCFFBXL2 E3 Ligase.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
23604317 2013 FBXL2- and PTPL1-mediated degradation of p110-free p85? regulatory subunit controls the PI(3)K signalling cascade.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22455980 2013 Neuronal expression of F-box and leucine-rich-repeat protein 2 decreases over Braak stages in the brains of Alzheimer's disease patients.
22399757 2012 FBL2 regulates amyloid precursor protein (APP) metabolism by promoting ubiquitination-dependent APP degradation and inhibition of APP endocytosis.
22323446 2012 F-box protein FBXL2 targets cyclin D2 for ubiquitination and degradation to inhibit leukemic cell proliferation.
22020328 2012 F-box protein FBXL2 exerts human lung tumor suppressor-like activity by ubiquitin-mediated degradation of cyclin D3 resulting in cell cycle arrest.
19159283 2009 Array MAPPIT: high-throughput interactome analysis in mammalian cells.
18160438 2008 Human butyrate-induced transcript 1 interacts with hepatitis C virus NS5A and regulates viral replication.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17784784 2007 Reliance of host cholesterol metabolic pathways for the life cycle of hepatitis C virus.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15893726 2005 Identification of FBL2 as a geranylgeranylated cellular protein required for hepatitis C virus RNA replication.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10945468 2000 cDNA cloning and expression analysis of new members of the mammalian F-box protein family.
10531037 1999 A family of mammalian F-box proteins.
10531035 1999 Identification of a family of human F-box proteins.
10508920 1999 Identification of a novel Skp2-like mammalian protein containing F-box and leucine-rich repeats.