Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q494R0 Q3KR42 Q8NAQ9
Symbols NCRNA00095

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MAEPGGRGDYRKDGRLPSLSRSPLSTTLGTSPACGLEIPPTSGARPDGSCSLPAPVYHLKSRQWKGMGRG      1 - 70
YRQRWRLQGRGDCDMGCVVQASGLFPAEMRERTTKKMATSPLDLCAGACWEM                       71 - 122
//

Text Mined References (4)

PMID Year Title