Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.03
PubTator Score 1.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession Q9UF56 A1A4E3
Symbols Fbl17
Fbx13
FBXO13

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (4)

PMID Text
24035498 Identify a role for SCF(FBXL17) in controlling the threshold for NRF2-dependent gene activation via BACH1 repressor turnover.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20200978 Observational study of gene-disease association. (HuGE Navigator)
18820369 F-box protein 17 (FBXL17) can serve as a therapeutic target and surrogate marker for breast cancer therapy.

AA Sequence

MGHLLSKEPRNRPSQKRPRCCSWCRRRRPLLRLPRRTPAKVPPQPAAPRSRDCFFRGPCMLCFIVHSPGA      1 - 70
PAPAGPEEEPPLSPPPRDGAYAAASSSQHLARRYAALAAEDCAAAARRFLLSSAAAAAAAAASASSPASC     71 - 140
CKELGLAAAAAWEQQGRSLFLASLGPVRFLGPPAAVQLFRGPTPSPAELPTPPEMVCKRKGAGVPACTPC    141 - 210
KQPRCGGGGCGGGGGGGGGGGPAGGGASPPRPPDAGCCQAPEQPPQPLCPPPSSPTSEGAPTEAGGDAVR    211 - 280
AGGTAPLSAQQQHECGDADCRESPENPCDCHREPPPETPDINQLPPSILLKIFSNLSLDERCLSASLVCK    281 - 350
YWRDLCLDFQFWKQLDLSSRQQVTDELLEKIASRSQNIIEINISDCRSMSDNGVCVLAFKCPGLLRYTAY    351 - 420
RCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYKISDEGMIVIAKGCL    421 - 490
KLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTKLRNLSSLDLRHITELDNETVME    491 - 560
IVKRCKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELYLVSCKITDYALIAIGRYSMTIETVDVGWCKEI    561 - 630
TDQGATLIAQSSKSLRYLGLMRCDKVNEVTVEQLVQQYPHITFSTVLQDCKRTLERAYQMGWTPNMSAAS    631 - 700
S//

Text Mined References (15)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24322204 2014 Genome-wide association study of bipolar disorder accounting for effect of body mass index identifies a new risk allele in TCF7L2.
24035498 2013 Parallel SCF adaptor capture proteomics reveals a role for SCFFBXL17 in NRF2 activation via BACH1 repressor turnover.
23118974 2012 Genome-wide association studies of quantitatively measured skin, hair, and eye pigmentation in four European populations.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20200978 2010 Replication of previous genome-wide association studies of bone mineral density in premenopausal American women.
18820369 Identification of F-box/LLR-repeated protein 17 as potential useful biomarker for breast cancer therapy.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.