Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.88
PubTator Score 1.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group A ependymoma -1.200 4.3e-11
osteosarcoma -1.014 1.2e-02
glioblastoma -1.100 5.6e-08
group 4 medulloblastoma -1.700 3.3e-06
atypical teratoid/rhabdoid tumor -1.200 3.8e-06
medulloblastoma, large-cell -1.100 5.3e-05
primitive neuroectodermal tumor -1.100 7.6e-04
adult high grade glioma -1.200 1.9e-05
pituitary cancer 1.100 7.8e-06

Gene RIF (1)

PMID Text
19955572 Data show that Twist1 small interfering RNA prevents hypoxia-induced Fbxl14 down-regulation and SNAIL1 stabilization.

AA Sequence

METHISCLFPELLAMIFGYLDVRDKGRAAQVCTAWRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGI      1 - 70
RRVQILSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLGRIAQ     71 - 140
YLKGLEVLELGGCSNITNTGLLLIAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEGCLGLEQLTLQ    141 - 210
DCQKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGLLHLSHMGSLRSLNLRSCDNISDTGIMHLAMGSLR    211 - 280
LSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSLCSCHISDDGINRMVRQMHGLRTLNIGQCVRITDKGLEL    281 - 350
IAEHLSQLTGIDLYGCTRITKRGLERITQLPCLKVLNLGLWQMTDSEKEARGDFSPLFTVRTRGSSRR      351 - 418
//

Text Mined References (6)

PMID Year Title
25203322 2014 PKD1 phosphorylation-dependent degradation of SNAIL by SCF-FBXO11 regulates epithelial-mesenchymal transition and metastasis.
19955572 2010 The hypoxia-controlled FBXL14 ubiquitin ligase targets SNAIL1 for proteasome degradation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.