Property Summary

NCBI Gene PubMed Count 15
PubMed Score 108.97
PubTator Score 47.99

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (2)

Gene RIF (6)

PMID Text
24412565 Results demonstrate that truncation of the evolutionarily conserved N-terminal residues of FBP2 results in a loss of its mitochondria-protective functions.
24063558 FBP2 does negatively regulate cell growth, and reduced expression of FBP2 may contribute to carcinogenesis for gastric cancer.
20800603 Observational study of gene-disease association. (HuGE Navigator)
18214967 The existence of highly AMP-sensitive muscle-like FBPase, activity of which is regulated by metabolite-dependent interaction with aldolase enables the precise regulation of muscle energy expenditures.
16213487 The key role in strong AMP binding to muscle isozyme play K20, T177 and Q179.
9282826 HIV-1 Matrix activates fructose 1,6-bisphosphatase gene expression by induction of a 1alpha-hydroxylase activity

AA Sequence

MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGIAGSVNVTGDE      1 - 70
VKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDPLDGSSNIDCLASIGTIFAIY     71 - 140
RKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQGVDLFMLDPALGEFVLVEKDVKIKKKGKIY    141 - 210
SLNEGYAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLY    211 - 280
ECNPVAYIIEQAGGLATTGTQPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS               281 - 339
//

Text Mined References (20)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24412565 2014 Changes in quaternary structure of muscle fructose-1,6-bisphosphatase regulate affinity of the enzyme to mitochondria.
24086250 2013 Crystal structures of human muscle fructose-1,6-bisphosphatase: novel quaternary states, enhanced AMP affinity, and allosteric signal transmission pathway.
24063558 2013 Decreased fructose-1,6-bisphosphatase-2 expression promotes glycolysis and growth in gastric cancer cells.
22120740 2011 Structure of E69Q mutant of human muscle fructose-1,6-bisphosphatase.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19893584 2010 Identification of 15 loci influencing height in a Korean population.
19626708 2009 Muscle FBPase is targeted to nucleus by its 203KKKGK207 sequence.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18214967 2008 Evolutionary conserved N-terminal region of human muscle fructose 1,6-bisphosphatase regulates its activity and the interaction with aldolase.
17350621 2007 Glu 69 is essential for the high sensitivity of muscle fructose-1,6-bisphosphatase inhibition by calcium ions.
16213487 2005 The origin of the high sensitivity of muscle fructose 1,6-bisphosphatase towards AMP.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12507293 2003 Immunohistochemical localization of human fructose-1,6-bisphosphatase in subcellular structures of myocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10773464 2000 Structure and chromosomal localization of the human and mouse muscle fructose-1,6-bisphosphatase genes.
9678974 1998 Isolation and characterization of an allelic cDNA for human muscle fructose-1,6-bisphosphatase.
9282826 1997 HIV-1 p17 and IFN-gamma both induce fructose 1,6-bisphosphatase.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.