Property Summary

NCBI Gene PubMed Count 60
PubMed Score 107.92
PubTator Score 113.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
nephrosclerosis -1.767 1.5e-02
urothelial carcinoma -1.700 3.2e-02
esophageal adenocarcinoma 1.800 1.8e-02
psoriasis -1.700 6.5e-05
osteosarcoma -1.298 5.0e-03
Atopic dermatitis -1.100 2.5e-02
adrenocortical carcinoma -1.842 3.3e-07
pancreatic ductal adenocarcinoma liver m... -2.152 1.6e-02
non-small cell lung cancer -2.890 1.8e-16
lung cancer -2.400 7.6e-05
breast carcinoma 2.100 3.1e-05
interstitial cystitis -3.600 2.1e-05
lung adenocarcinoma -1.400 6.6e-04
lung carcinoma -2.300 2.7e-20
ductal carcinoma in situ 1.300 3.3e-02
invasive ductal carcinoma 1.500 6.7e-03
ovarian cancer -2.100 1.2e-09
Breast cancer -1.100 1.3e-02

Protein-protein Interaction (1)

Gene RIF (28)

PMID Text
26546081 identified Zinc finger E-box-binding homeobox 1 (ZEB1) bond to FBP1 promoter to enhance DNA methylation in lung cancer cells. Our findings indicate that the down-regulation of FBP1 is a critical oncogenic event in lung cancer progression
26469968 FBP1 expression, which is closely correlated with c-Myc expression, is an independent prognostic factor and promotes nasopharyngeal carcinoma progression.
26068981 NPM1 promotes aerobic glycolysis and tumor progression in patients with pancreatic cancer by inhibiting FBP1
25844935 There was a negative correlation with the level of FBP1 and recurrence of the lung cancer
25601412 Twelve different mutations were identified in 22 alleles: one missense mutation c.472C > T, one point deletion c.48del, one point duplication c.865dupA, one deletion-insertion, and two splice mutations (c.427-1del and c.825 + 1G > A).
25043030 the gluconeogenic enzyme fructose-1,6-bisphosphatase 1 (FBP1) is uniformly depleted in over six hundred clear cell renal cell carcinoma tumours examined.
24146906 Ca(2+) affects conformation of the catalytic loop 52-72 of muscle FBPase and inhibits its activity by competing with activatory divalent cations, e.g. Mg(2+) and Zn(2+).
24007283 A homozygous c.658delT mutation was detected at exon 5 of the FBP1 gene in the two siblings with FBPase deficiency.
23881342 A novel missense mutation (c.841G>A) in the FBP1 gene seems to be prevalent in Pakistani-Indian patients with fructose-1,6-bisphosphatase deficiency.
23755305 LSD1 regulates transcription activation of two gluconeogenic genes, FBP1 and G6Pase.
23453623 study indicates that the loss of FBP1 is a critical oncogenic event in epithelial-mesenchymal transition and basal-like breast cancer
22517657 This is the first study to identify liver FBPase as a previously unknown regulator of appetite and adiposity and describes a novel process by which the liver participates in body weight regulation.
22120740 AMP binding pattern of the muscle isozyme of fructose-1,6-bisphosphatase is quite similar to that of the liver isozyme and the T conformations of the two isozymes are nearly the same
22057438 The Identification of FBPase interacting partners with mass spectrometry reveals a set of nuclear proteins involved in cell cycle regulation, mRNA processing and in stabilization of genomic DNA structure.
22039417 epigenetic inactivation of FBP1 is also common in human liver and colon cancer. FBP1 appears to be a functional tumor suppressor involved in the liver and colon carcinogenesis
20151204 Case Reports: present reliable diagnostic system to verify an FBPase deficiency and find the genetic aberration.
20096900 Novel compound heterozygous mutations in the fructose-1,6-bisphosphatase gene cause hypoglycemia and lactic acidosis.
19881551 Data show that NF-kappaB functions downstream of Ras to promote epigenetic downregulation of FBP1.
19626708 this is the first experimental evidence confirming that the KKKGK motif can act as a functional NLS fructose 1,6-bisphosphatase .
19505453 Data show that EDTA and mercaptoethanol stabilized FBP-1 activity in stored urine.
19259699 first report on mutations in patients with FBP deficiency of Arab ethnicity,two novel mutations in the FBP1 gene encode for a duplication of two amino acids and a truncation in the FBP1 protein in these families.
18978678 Observational study of gene-disease association. (HuGE Navigator)
18780768 Human FBP1 was found to regulate mouse endogenous glucose production and whole body glucose homeostasis in a liver-specific transgenic model.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18460190 Observational study of gene-disease association. (HuGE Navigator)
18375435 Upregulation of FBPase in pancreatic islet beta-cells in states of lipid oversupply and type 2 diabetes, contributes to insulin secretory dysfunction.
15965961 liver fructose-1,6-bisphosphatase coupled with phosphofructokinase (PFK) plays a crucial role in the metabolism of pancreatic islet cells
9282826 HIV-1 Matrix activates fructose 1,6-bisphosphatase gene expression by induction of a 1alpha-hydroxylase activity

AA Sequence

MADQAPFDTDVNTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQ      1 - 70
VKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIY     71 - 140
RKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIY    141 - 210
SLNEGYARDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLY    211 - 280
ECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPVILGSPDDVLEFLKVYEKHSAQ                281 - 338
//

Text Mined References (65)

PMID Year Title
26546081 2016 Down-regulation of FBP1 by ZEB1-mediated repression confers to growth and invasion in lung cancer cells.
26469968 2015 Far upstream element-binding protein 1 is a prognostic biomarker and promotes nasopharyngeal carcinoma progression.
26068981 2015 NPM1 activates metabolic changes by inhibiting FBP1 while promoting the tumorigenicity of pancreatic cancer cells.
25844935 2015 Down Expression of FBP1 Is a Negative Prognostic Factor for Non-Small-Cell Lung Cancer.
25601412 2015 Fructose 1,6-bisphosphatase deficiency: clinical, biochemical and genetic features in French patients.
25416956 2014 A proteome-scale map of the human interactome network.
25043030 2014 Fructose-1,6-bisphosphatase opposes renal carcinoma progression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24146906 2013 The mechanism of calcium-induced inhibition of muscle fructose 1,6-bisphosphatase and destabilization of glyconeogenic complex.
24007283 2013 Novel fructose-1,6-bisphosphatase gene mutation in two siblings.
23881342 2013 Transient pseudo-hypertriglyceridemia: a useful biochemical marker of fructose-1,6-bisphosphatase deficiency.
23755305 2013 Suppression of gluconeogenic gene expression by LSD1-mediated histone demethylation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23453623 2013 Loss of FBP1 by Snail-mediated repression provides metabolic advantages in basal-like breast cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22517657 2012 The role of liver fructose-1,6-bisphosphatase in regulating appetite and adiposity.
22120740 2011 Structure of E69Q mutant of human muscle fructose-1,6-bisphosphatase.
22057438 2012 Cell cycle-dependent expression and subcellular localization of fructose 1,6-bisphosphatase.
22039417 2011 Promoter hypermethylation mediated downregulation of FBP1 in human hepatocellular carcinoma and colon cancer.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20151204 2010 Fructose 1,6-bisphosphatase deficiency: enzyme and mutation analysis performed on calcitriol-stimulated monocytes with a note on long-term prognosis.
20096900 2011 Novel compound heterozygous mutations in the fructose-1,6-bisphosphatase gene cause hypoglycemia and lactic acidosis.
19881551 2010 Warburg effect revisited: an epigenetic link between glycolysis and gastric carcinogenesis.
19626708 2009 Muscle FBPase is targeted to nucleus by its 203KKKGK207 sequence.
19505453 2009 Stabilizing the urinary activity of fructose-1,6-bisphosphatase with EDTA and mercaptoethanol.
19259699 2009 Novel FBP1 gene mutations in Arab patients with fructose-1,6-bisphosphatase deficiency.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18780768 2008 Increased glucose production in mice overexpressing human fructose-1,6-bisphosphatase in the liver.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18650089 2008 Allosteric FBPase inhibitors gain 10(5) times in potency when simultaneously binding two neighboring AMP sites.
18460190 2008 The estrogen hypothesis of schizophrenia implicates glucose metabolism: association study in three independent samples.
18375435 2008 Fructose-1,6-bisphosphatase overexpression in pancreatic beta-cells results in reduced insulin secretion: a new mechanism for fat-induced impairment of beta-cell function.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17350621 2007 Glu 69 is essential for the high sensitivity of muscle fructose-1,6-bisphosphatase inhibition by calcium ions.
16497803 2006 Expression of human fructose-1,6-bisphosphatase in the liver of transgenic mice results in increased glycerol gluconeogenesis.
16446092 2006 Benzoxazole benzenesulfonamides as allosteric inhibitors of fructose-1,6-bisphosphatase.
16442285 2006 Benzoxazole benzenesulfonamides are novel allosteric inhibitors of fructose-1,6-bisphosphatase with a distinct binding mode.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16275660 2006 Identification of VCP/p97, carboxyl terminus of Hsp70-interacting protein (CHIP), and amphiphysin II interaction partners using membrane-based human proteome arrays.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15965961 2005 Novel expression of liver FBPase in Langerhans islets of human and rat pancreas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
12507293 2003 Immunohistochemical localization of human fructose-1,6-bisphosphatase in subcellular structures of myocytes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12126934 2002 Two newly identified genomic mutations in a Japanese female patient with fructose-1,6-bisphosphatase (FBPase) deficiency.
10222032 1999 cDNA sequence and kinetic properties of human lung fructose(1, 6)bisphosphatase.
9382095 1997 Identification of genetic mutations in Japanese patients with fructose-1,6-bisphosphatase deficiency.
9380240 1997 Graft ischemia correlates with urinary excretion of the proximal marker enzyme fructose-1,6-bisphosphatase in human kidney transplantation.
9282826 1997 HIV-1 p17 and IFN-gamma both induce fructose 1,6-bisphosphatase.
8530070 1995 Fructose-1,6-bisphosphatase: genetic and physical mapping to human chromosome 9q22.3 and evaluation in non-insulin-dependent diabetes mellitus.
8387495 1993 Isolation of a human liver fructose-1,6-bisphosphatase cDNA and expression of the protein in Escherichia coli. Role of ASP-118 and ASP-121 in catalysis.
8382525 1993 Crystallographic studies of the catalytic mechanism of the neutral form of fructose-1,6-bisphosphatase.
8135811 1994 cDNA sequences encoding human fructose 1,6-bisphosphatase from monocytes, liver and kidney: application of monocytes to molecular analysis of human fructose 1,6-bisphosphatase deficiency.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7809062 1994 Crystal structure of fructose-1,6-bisphosphatase complexed with fructose 2,6-bisphosphate, AMP, and Zn2+ at 2.0-A resolution: aspects of synergism between inhibitors.
7763253 1995 Identification of a genetic mutation in a family with fructose-1,6- bisphosphatase deficiency.
7589895 1995 Liver fructose-1,6-bisphosphatase cDNA: trans-complementation of fission yeast and characterization of two human transcripts.
7558035 1995 Human fructose-1,6-bisphosphatase gene (FBP1): exon-intron organization, localization to chromosome bands 9q22.2-q22.3, and mutation screening in subjects with fructose-1,6-bisphosphatase deficiency.
2842796 1988 Activation of the fructose 1,6-bisphosphatase gene by 1,25-dihydroxyvitamin D3 during monocytic differentiation.
2164670 1990 Crystal structure of fructose-1,6-bisphosphatase complexed with fructose 6-phosphate, AMP, and magnesium.
1846613 1991 The rat fructose-1,6-bisphosphatase gene. Structure and regulation of expression.