Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.27
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
pancreatic cancer 1.700 2.1e-04
malignant mesothelioma -4.900 2.7e-09
psoriasis -1.400 1.2e-03
osteosarcoma -3.275 5.8e-08
group 3 medulloblastoma -2.500 2.2e-05
non diabetic and post-ischemic heart fai... 1.600 8.9e-04
type II diabetes mellitus and post-ische... 1.400 1.5e-02
medulloblastoma, large-cell -2.000 8.5e-06
Atopic dermatitis -1.100 6.5e-04
pancreatic ductal adenocarcinoma liver m... -1.068 1.9e-02
non-small cell lung cancer -2.177 1.6e-18
lung cancer -2.900 4.5e-05
colon cancer -2.000 5.7e-04
breast carcinoma -2.000 4.8e-06
non-inflammatory breast cancer -2.200 1.9e-02
lung adenocarcinoma -1.500 2.8e-12
pancreatic carcinoma 1.700 2.1e-04
invasive ductal carcinoma -2.600 5.6e-04
mucosa-associated lymphoid tissue lympho... 1.630 1.3e-02
ductal carcinoma in situ -2.000 1.2e-04
ovarian cancer -1.700 7.8e-13

AA Sequence

MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFWQAQWERLLTT      1 - 70
FEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKNEPVDPVKLRQSIRTVLFNQC     71 - 140
MISFPMVVFLYPFLKWWRDPCRRELPTFHWFLLELAIFTLIEEVLFYYSHRLLHHPTFYKKIHKKHHEWT    141 - 210
APIGVISLYAHPIEHAVSNMLPVIVGPLVMGSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHH    211 - 280
LKFNQCYGVLGVLDHLHGTDTMFKQTKAYERHVLLLGFTPLSESIPDSPKRME                     281 - 333
//

Text Mined References (6)

PMID Year Title
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10843801 2000 Transcription mapping of the 5q- syndrome critical region: cloning of two novel genes and sequencing, expression, and mapping of a further six novel cDNAs.