Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -3.100 6.7e-05
astrocytic glioma -2.400 2.0e-03
Astrocytoma, Pilocytic -2.300 1.2e-05
atypical teratoid / rhabdoid tumor -3.500 7.1e-10
ductal carcinoma in situ 1.300 2.4e-02
ependymoma -2.700 2.8e-03
glioblastoma -2.500 1.1e-07
head and neck cancer -1.200 1.1e-02
lung carcinoma 1.100 1.1e-15
medulloblastoma -1.800 9.2e-04
medulloblastoma, large-cell -2.300 3.5e-06
non-small cell lung cancer 1.735 2.8e-12
oligodendroglioma -1.800 2.9e-02
Pick disease -1.200 8.3e-03
subependymal giant cell astrocytoma -1.922 8.4e-03

AA Sequence

MHWGVGFASSRPCVVDLSWNQSISFFGWWAGSEEPFSFYGDIIAFPLQDYGGIMAGLGSDPWWKKTLYLT      1 - 70
GGALLAAAAYLLHELLVIRKQQEIDSKDAIILHQFARPNNGVPSLSPFCLKMETYLRMADLPYQNYFGGK     71 - 140
LSAQGKMPWIEYNHEKVSGTEFIIDFLEEKLGVNLNKNLGPHERAISRAVTKMVEEHFYWTLAYCQWVDN    141 - 210
LNETRKMLSLSGGGPFSNLLRWVVCHITKGIVKREMHGHGIGRFSEEEIYMLMEKDMRSLAGLLGDKKYI    211 - 280
MGPKLSTLDATVFGHLAQAMWTLPGTRPERLIKGELINLAMYCERIRRKFWPEWHHDDDNTIYESEESSE    281 - 350
GSKTHTPLLDFSFYSRTETFEDEGAENSFSRTPDTDFTGHSLFDSDVDMDDYTDHEQCK               351 - 409
//

Text Mined References (6)

PMID Year Title