Property Summary

NCBI Gene PubMed Count 19
PubMed Score 22.45
PubTator Score 5.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count
Liver carcinoma 217

Expression

Synonym

Accession Q969F0
Symbols CT43
FATE

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
26567849 FATE1 is a key survival factor in multiple oncogenic backgrounds. FATE1 prevents the accumulation of the stress-sensing BH3-only protein, BCL-2-Interacting Killer (BIK), thereby permitting viability in the presence of toxic stimuli.
18976975 Knockdown of fetal and adult testis expressed 1 (FATE1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
12811541 This study has shown that only 1.4% of infertile men have mutations in the FATE gene, and that some of these mutations do not singly cause infertility.

AA Sequence

MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAGSASAKRVWNM      1 - 70
TATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDAVAQTSLEEFNVLEMEVMRRQ     71 - 140
LYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLWMNQ                               141 - 183
//

Text Mined References (19)

PMID Year Title
26567849 2015 Comprehensive functional characterization of cancer-testis antigens defines obligate participation in multiple hallmarks of cancer.
25416956 2014 A proteome-scale map of the human interactome network.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21516116 2011 Next-generation sequencing to generate interactome datasets.
17761949 2007 Increased steroidogenic factor-1 dosage triggers adrenocortical cell proliferation and cancer.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15580283 2005 Immunohistochemical analysis of the expression of FATE/BJ-HCC-2 antigen in normal and malignant tissues.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12865919 2003 Identification of two novel CT antigens and their capacity to elicit antibody response in hepatocellular carcinoma patients.
12811541 2003 Mutational analysis of the human FATE gene in 144 infertile men.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11694338 2001 Human FATE is a novel X-linked gene expressed in fetal and adult testis.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11134355 2001 Identification of human candidate genes for male infertility by digital differential display.
11076863 2000 DNA cloning using in vitro site-specific recombination.