Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.90
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.600 2.1e-03
intraductal papillary-mucinous neoplasm ... 1.200 9.5e-03
malignant mesothelioma 1.100 3.3e-06
ovarian cancer -1.300 1.3e-04

Gene RIF (5)

AA Sequence

MALITLRKNLYRLSDFQMHRALAALKNKPLNHVHKVVKERLCPWLCSRQPEPFGVKFHHAHCKKFHSKNG      1 - 70
NDLHPLGGPVFSQVSDCDRLEQNVKNEESQMFYRRLSNLTSSEEVLSFISTMETLPDTMAAGALQRICEV     71 - 140
EKKDGDQGLPKEILENSIFQALCFQFEKEPSQLSNTSLVTALQALILLHVDPQSSLLLNLVAECQNRLRK    141 - 210
GGMEVRNLCILGESLITLHSSGCVTLELIINQLQGEKLETFTPEDIVALYRILQACTEKVDEHQTFLNKI    211 - 280
NNFSLSIVSNLSPKLISQMLTALVVLDQSQAFPLIIKLGKYVVRHVPHFTNEELRRVLEAFIYFGHHDTF    281 - 350
FTKALEHRVAAVCLTLDPEVVCRVMEYCSRELILSKPILNAVAETFVCQTEKFSPRQISALMEPFGKLNY    351 - 420
LPPNASALFRKLENVLFTHFNYFPPKSLLKLLHSCSLNECHPVNFLAKIFKPLFLQRLQGKESHLDTLSR    421 - 490
AQLTQLFLASVLECPFYKGPKLLPKYQVKSFLTPCCSLETPVDSQLYRYVKIGLTNLLGARLYFAPKVLT    491 - 560
PYCYTIDVEIKLDEEGFVLPSTANEDIHKRIALCIDGPKRFCSNSKHLLGKEAIKQRHLQLLGYQVVQIP    561 - 630
YHEIGMLKSRRELVEYLQRKLFSQNTVHWLQE                                          631 - 662
//

Text Mined References (13)

PMID Year Title