Property Summary

NCBI Gene PubMed Count 196
PubMed Score 348.46
PubTator Score 756.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
oligodendroglioma 1.300 2.1e-02
psoriasis -1.400 1.0e-02
osteosarcoma 1.664 9.1e-03
atypical teratoid / rhabdoid tumor 1.300 2.4e-04
glioblastoma -1.200 1.5e-05
medulloblastoma, large-cell 2.000 4.9e-05
autosomal dominant Emery-Dreifuss muscul... 1.028 2.7e-03
acute quadriplegic myopathy 1.909 4.6e-06
pancreatic ductal adenocarcinoma liver m... -1.488 1.0e-02
active ulcerative colitis 1.050 9.7e-03
interstitial cystitis -1.100 7.1e-04
adult high grade glioma -1.300 5.7e-04
subependymal giant cell astrocytoma -1.599 1.7e-02
Breast cancer 1.700 2.4e-07
pituitary cancer -1.700 6.3e-05

Protein-protein Interaction (6)

MLP Assay (12)

AID Type Active / Inconclusive / Inactive Description
602261 screening 2430 / 0 / 359958 uHTS identification of small molecule inhibitors of the thioesterase domain of fatty acid synthase via a fluorescence intensity assay
602265 summary 0 / 0 / 0 Summary assay for small molecule inhibitors of the thioesterase domain of fatty acid synthase
624325 screening 1009 / 0 / 1246 Single concentration confirmation of uHTS inhibitor hits of the thioesterase domain of fatty acid synthase via a fluorescence intensity assay
624326 confirmatory 967 / 0 / 44 Dose response confirmation of small molecule inhibitors of the thioesterase domain of fatty acid synthase via a kinetic, fluorescence intensity assay
624327 confirmatory 969 / 0 / 42 Dose response confirmation of uHTS inhibitor hits of the thioesterase domain of fatty acid synthase via a fluorescence intensity assay
651670 confirmatory 8 / 0 / 13 SAR analysis of small molecule inhibitors of the thioesterase domain of fatty acid synthase via a fluorescence intensity assay
651979 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA1: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
651980 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
652164 confirmatory 31 / 0 / 8 SAR confirmation of small molecule inhibitors of the thioesterase domain of fatty acid synthase via a fluorescence intensity assay
652165 confirmatory 32 / 0 / 7 SAR confirmation of small molecule inhibitors of the thioesterase domain of fatty acid synthase via a kinetic, fluorescence intensity assay
More...

Gene RIF (165)

PMID Text
26663084 Data suggest that thioesterase 2 (TE2) catalytic domain of FASN exhibits novel capping domain insert within the alpha/beta hydrolase core; TE2 (as opposed to TE1 domain) readily releases short chain fatty acids from full-length FASN during turnover.
26514456 Our results suggest that FASN upregulation and PTEN downregualtion may be involved in peritoneal dissemination for gastric cancer progression.
26425687 data demonstrate that selective and potent FASN inhibition with TVB-3166 leads to selective death of tumor cells, without significant effect on normal cells, and inhibits in vivo xenograft tumor growth at well-tolerated doses.
26378037 concluded that EGFR can be activated intracellularly by FASN-dependent palmitoylation
26134042 In the present study it was determined whether three key enzymes for glycolysis, glutaminolysis and de novo synthesis of FAs, hexokinase-2, glutaminase and fatty acid synthase
26109148 Loss of fatty acid synthase suppresses the malignant phenotype of colorectal cancer cells by down-regulating energy metabolism and mTOR signaling pathway.
26107737 FASN and HER2 have roles in breast cancer and are blocked by EGCG with pertuzumab or temsirolimus
26025399 The results suggested that differential levels of P-glycoprotein, Caveolin-1 and Fatty acid synthase except CYP450 play a major role in acquired resistant phenotype in bladder cancer.
25970773 Findings indicate that overexpression of FASN plays a crucial role in maintaining energy homeostasis in CRC via increased oxidation of endogenously synthesized lipids.
25958981 Results showed correlated FASN regulation relative to key signaling genes with tumor invasion and differentiation in primary retinoblastoma (RB) tissues. Its silencing exerted definite anti-cancer effects in RB cells through PI3K/AKT signaling pathway.
25947066 FASN inhibition induced apoptosis in chemosensitive and platinum-resistant ovarian cancer cells and may reverse cisplatin resistance.
25871544 The results reveal that the cytotoxic effects of FASN inhibitors in sensitive lines may be due to the robust depletion of oncogenic signaling lipids, such as diacylglycerols and the elevation of tumor-suppressing ceramides.
25868764 Overall, no SNPs were associated with any known aggressiveness indicators. FASN staining intensity was stronger in malignant than in benign tissue, and NADT was associated with decreased FASN staining in both benign and malignant tissue
25855506 TG levels are regulated by HCBP6-sterol regulatory element binding protein 1c (SREBP1c)-mediated fatty acid synthase (FASN) expression.
25674245 Our findings suggested that there was positive feedback regulation between FASN and HER2 expression and phosphorylation in osteosarcoma cells.
25631074 Cellular biotinylated fatty acid synthase protein (FASN) is incorporated into HIV-1 Gag virus-like particles
25433947 These results for the first time indicated that a cross talk in FASN and HER2 expressions might be associated with prognosis in malignant ovarian cancer.
25301948 Crystal structure of the human fatty acid synthase enoyl-acyl carrier protein-reductase domain complexed with triclosan reveals allosteric protein-protein interface inhibition.
25231933 FASN is possibly involved in the occurrence and metastasis of hepatocellular carcinoma.
25227797 rs4246444 and rs4485435 were associated with recurrence in non-small cell lung cancer.
25173531 results revealed that FASN and ox-LDL as well as oxidative stress may increase the risk of obesity related colon cancer
25151963 the initiator caspase-2 is required for robust death of ovarian cancer cells induced by FASN inhibitors
25034529 MicroRNA-142-3p inhibits the protein expression of FASN in osteosarcoma cell linesthrough binding to its 3'-untranslated region
24907642 This is the first report of FASN localization to the nucleus in prostate cancer
24789255 Results show that overexpression of FASN correlates with glioma WHO tumor grade and FASN inhibition lead to repression of cell growth and angiogenesis and to an enhancement of apoptosis and necrosis in glioblastoma cell cultures
24696471 Rab18-mediated membrane trafficking of FASN and NS3 facilitates dengue virus replication.
24596388 Up-regulation of fatty acid synthase expression confers resistance to trastuzumab in HER2-positive breast cancers.
24520215 FASN is essential to epithelial-mesenchymal transition possibly through regulating L-FABP, VEGF and VEGFR-2.
24510238 Cancer cell-associated fatty acid synthase activates endothelial cells and promotes angiogenesis in colorectal cancer.
24390663 results further revealed that the expression of fatty acid synthase (FASN), a key enzyme for de novo biosynthesis of fatty acids, was negatively regulated by miR-320
24366211 The findings from our study suggest the existence of a positive feedback regulation between Akt phosphorylation and FASN expression and that this loop may play an important role in the malignant phenotype of osteosarcoma cells.
24362464 These results suggest that FASN is a potential molecular target for the chemotherapy of patients with oral tongue squamous cell carcinoma .
24337182 data suggest that FASN overexpression occurs as a late event during the progression from intratubular germ cell neoplasias, unclassified/seminomas to non-seminomatous germ cell tumors
24277691 Protective effects of breastfeeding are reflected in higher expression levels of SLC27A2, FASN, PPARalpha and INSR in blood cells.
24200503 Endogenously synthesized fatty acids by FAS do not fulfill a specific function in cancer cells suggesting that FAS has role beyond providing fatty acids for phospholipids and in glycolytic activity.
24108439 Increased fatty acid synthase expression in prostate biopsy predicts upgraded Gleason score.
24105476 Sterol regulatory element-binding protein-1/FASN is involved in the proliferation suppression and apoptosis promotion brought about by megestrol acetate in Ishikawa cells.
24080588 FASN regulated gene expression which in turn contribute to resistance to drug and radiation-induced apoptosis. [review]
23982110 findings suggest that fatty acid synthase could be a potential therapeutic target in postmenopausal breast cancer patients
23887214 The soluble-Fas level is high in Saudi children with severe autism, and can be considered an indicator of disease severity.
23725225 A downregulation of FASN effectively inhibits the activity of "HER2-PI3K/Akt axis" and alters the malignant phenotype in colorectal cancer cells.
23675653 Upregulation of host hepatic fatty acid synthase correlates with hepatitis B virus replication.
23427160 Hepatitis C virus replication is modulated by the interaction of viral NS5B and fatty acid synthase.
23419663 FAS and HER2 overexpression are common in esophageal carcinomas
23317220 High fatty acid synthase expression is associated with breast cancer.
23306391 High FASN expression is associated with endometrioid endometrial cancer.
23269672 Modulation of fatty acid synthase degradation by concerted action of p38 MAP kinase, E3 ligase COP1, and SH2-tyrosine phosphatase Shp2.
23208675 Overexpression of FASN promotes cell growth and radiation resistance in nasopharyngeal carcinoma.
23184344 Inhibition of PP2A by okadaic acid curtailed the free fatty acids induced upregulation of SREBP1 expression, fatty acid synthase promoter transcriptional activity and lipid accumulation in HepG2 cells.
23142364 Data suggest that conjugated linoleic acids (dietary factors) exhibit regulatory effects on expression of FASN in breast neoplasm cells; the effect varies in estrogen receptor-positive versus estrogen receptor-negative tumor cells.
23135268 GPER may be included among the transduction mediators involved by estrogens in regulating FASN expression and activity in cancer cells and cancer-associated fibroblasts that strongly contribute to cancer progression.
23125841 Cellular biotinylated fatty acid synthase protein (FASN) is incorporated into HIV-1 Gag virus-like particles
23064941 It is the enzyme responsible for the de novo synthesis of fatty acids and its level of expression in glioma is considered as a diagnostic tumor marker.
23040493 FASN represents the initial UL risk allele identified in white women by a genome-wide.
22949843 fatty acid synthase overexpression is associated with hepatocellular carcinoma.
22786746 Reduction of FASN induces hypoxic cell death via malonyl-CoA accumulation.
22771636 Results showed that the FASN expression level in the osteosarcoma cases with pulmonary metastases was significantly higher than in those without metastasis.
22723001 FASN was detected in 95 percent of esophageal squamous cell carcinoma, in 90 percent of esophageal adenocarcinoma samples and was undectectable in healthy tissue.
22653145 NAC1 expression was significantly correlated with FASN expression in both OCCC samples and OCCC cell lines.
22490687 t-AUCB may prevent the ruptures of atherosclerotic lesions by regulating FASN and inhibiting inflammatory reactions in coronary syndrome.
22425483 Fatty acid synthase (FASN) seems to be involved in the pathogenesis of nasal melanomas, and also, it can be helpful to confirm the diagnosis.
22266115 It was found that elevated expression of fatty acid synthase is associated with advanced stages of colorectal cancer and liver metastasis. Targeted knockdown of fatty acid synthase abolished CD44 expression.
22135723 overexpressions of FASN and p-c-Met were observed in a subset of thyroid carcinomas of follicular origin
22127986 Fatty acid synthase expression is deregulated in tumor and structurally intact adjacent prostate tissues and defines field cancerization.
21970855 FASN inhibition not only abrogates lipogenesis, which is indispensable for cancer growth, but also downregulates oncogenic PI3K signaling.
21922386 fatty acid synthase expression can be a biomarker for tumor aggressiveness and loss of differentiation of bladder cancer
21908709 Results offer a new framework for developing potent FAS inhibitors as therapeutics against cancers and other diseases.
21877200 These findings suggest that fatty acid synthase may participate in the crosstalk between fat and bone metabolism.
21757596 We conclude that FASn may aid in the diagnosis of prostatic adenocarcinoma
21726077 three major enzymes of the pathway, FASN, ACC, and ACLY, are up-regulated in numerous tumor types.
21646813 results suggest that dietary fat intake may modify the effect of the FASN rs4246444 polymorphism on LDL-PPD
21641044 The Val1483Ile polymorphism in the FASN was associated with depressive symptoms under the influence of psychological stress. The S variant of 5-HTTLPR was related with less obese.
21442130 Data indicate that overexpression of FASN was detected in 75.5% (114/151) of the tumor samples.
21325951 FASN is strongly expressed in intestinal mucin phenotype of Barrett's esophagus, in which Barrett's glandular cells display elevated cellular proliferation, angiogenesis, and COX-2 expression. Bile acid with low pH may induce FASN in Barrett's esophagus.
21044743 Increased fatty acid synthase activity in non-small cell lung cancer tissue is a weaker predictor of shorter patient survival than increased lipoprotein lipase activity.
20965718 Observational study of gene-disease association. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
20811782 In hepatic cells, hexanoate needs to be activated into a CoA derivative in order to inhibit the insulin and T(3)-induced FAS expression. This effect is partially transcriptional, targeting the TRE on the FAS promoter.
20691427 Observational study of gene-disease association. (HuGE Navigator)
20691246 Data show PEPCK-C and CPT-1 mRNAs are more abundant in non-tumoral tissues than in the tumoral counterpart, whereas the opposite occurred for the FAS gene.
20679621 FASN germline polymorphisms were significantly associated with risk of lethal PCa.
20679621 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20657182 Data show that FAS is expressed at very high levels in esophageal cancer and growth of these cancers can be inhibited by pharmacological agents that target this enzyme.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20606731 Fatty acid synthase may serve as a new diagnostic marker or therapeutic target for the progression of nonalcoholic fatty liver disease
20602615 Observational study of gene-disease association. (HuGE Navigator)
20546348 the diagnostic value of fatty acid synthase as a prostatic cancer immunohistochemical marker.
20511185 our data suggest that the increased FAS expression in human meningiomas represents a novel therapeutic target for the treatment of unresectable or malignant meningioma.
20356977 Hyperglycaemia conferred resistance on malignant cells, but not on non-malignant cells, to chemotherapy-induced cell death. This resistance was overcome by inhibiting FAS or ceramide production.
20299470 FASN is a biomarker of overnutrition-induced insulin resistance that could provide diagnostic and prognostic advantages by providing insights on the individualized metabolic stress.
20228782 Suggest that overexpression of Rsf-1, cyclin E and FASN occurs early in ovarian tumor progression.
20132826 The authors describe the high-resolution crystal structure of a large part of human FAS that encompasses the tandem domain of beta-ketoacyl synthase (KS) connected by a linker domain to the malonyltransferase (MAT) domain.
20126469 HBxDelta127 promotes cell growth through a positive feedback loop involving 5-LOX and fatty acid synthase
20067991 SDF-1alpha/CXCR4 axis is a novel upstream pathway of FASN expression and is associated with mediating its prosurvival effect.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19893031 FASN is expressed in the majority of gestational trophoblastic neoplasias
19885560 serum FASN-positive metastatic breast cancer patients had about two times higher blood serum levels of HER2 extracellular domain than sFASN negative patients MBC patients.
19876008 Polymorphisms in FASN are associated with obesity in case control studies.
19876008 Observational study of gene-disease association. (HuGE Navigator)
19851294 there is a decrease of FASN expression in hypertensive individuals.
19728851 Serum FASN concentrations are increased in patients with chronic liver impairment, and are associated with specific histological alterations and biochemical markers of portal inflammation.
19621387 Results demonstrate by RNA interference that Sp1 regulating CDC25A and FAS expression and proliferation in cancer cells.
19543203 Fatty acid synthase was down-regulated in visceral adipose tissue from obese subjects, with and without diabetes mellitus type 2
19517019 FASN is a functionally relevant target of p63 and is required for mediating its pro-survival effects
19471962 The over-expression of p53, Ki67 and FAS in otherwise similar morphological groups may be useful to stratify patients into selected prognostic subgroups in order to achieve better clinical approaches.
19467222 the effect of FASN and ErbB inhibition on A2780 and SKOV3 ovarian cancer cells was examined.
19358283 Increased expression of fatty acid synthase is associated with colorectal cancer.
19318631 FASN can act as a prostate cancer oncogene in the presence of AR and that FASN exerts its oncogenic effect by inhibiting the intrinsic pathway of apoptosis.
19300427 Adult white men with the Ile 1483 variant of the FASN gene seem protected from developing central obesity through decreased adipose tissue FASN activity.
19300427 Observational study of gene-disease association. (HuGE Navigator)
19252981 we were not able to find any statistically significant association between the single nucleotide polymorphisms in the FAS, ChREBP and SREPB-1 genes and an increased risk of breast cancer
19252981 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19083124 No differences between BRCA1 mutation carriers and 22 non-carriers were found in the expression of CYP1B1 and fatty acid synthase in breast cancer patients
19032940 FASN release from cancer cells is an active and controlled process that takes place by AMPK-sensed stimuli that increase the cellular AMP/ATP ratio.
18955444 Cohort study of fatty acid synthase expression and patient survival in colon cancer.
18838960 propose that cytoplasmic stabilization of beta-catenin through palmitoylation of Wnt-1 and subsequent activation of the pathway is a potential mechanism of FASN oncogenicity in prostate cancer
18830996 Hepatitis C virus infection directly induces FASN expression, and thus suggests a possible mechanism by which infection alters the cellular lipid profile and causes diseases such as steatosis.
18820672 expression did not correlate significantly with the outcome in breast cancer
18802406 Co-expression of fatty acid synthase and caveolin-1 in pancreatic ductal adenocarcinoma.
18796435 unique effect of inhibition of FAS results from negative regulation of the mTOR pathway via DDIT4
18682509 FASN and activated AKT pathway may be a potential target for therapeutic intervention for the treatment of papillary thyroid carcinomas.
18682402 Proto-oncogene FBI-1 (Pokemon) and SREBP-1 synergistically activate transcription of fatty-acid synthase gene
18660489 Observational study of gene-disease association. (HuGE Navigator)
18635971 These findings suggest that FASN and Cav-1 physically and functionally interact in PCa cells.
18528705 Fatty acid synthase is overexpressed in oral or head and neck squamous cell carcinomas and hyperkeratotic oral epithelium.
18420801 Taken together, results suggest that HCV NS2 can upregulate the transcription of SREBP-1c and FAS, and thus is probably a contributing factor for HCV-associated steatosis.
18410580 expression in squamous cell carcinoma of the tongue is associated with microscopic characteristics that determine disease progression and prognosis
18281512 FASN overexpression is a new mechanism of drug resistance and may be an ideal target for chemosensitization in breast cancer chemotherapy.
18281474 FAS gene is up-regulated by hypoxia via activation of the Akt and HIF1 followed by the induction of the SREBP-1 gene, and that hypoxia-induced chemoresistance is partly due to the up-regulation of FAS.
18239060 Dietary soy protein, by decreasing circulating insulin levels and colon FASN expression, attenuates insulin-induced DNA damage and FASN-mediated anti-apoptosis during carcinogenesis.
18211286 cannot definitely establish FASN as a novel oncogene in breast cancer, but this study reveals that exacerbated endogenous FA biosynthesis in non-cancerous epithelial cells is sufficient to induce a cancer-like phenotype dependent on HER1/HER2 duo
17847090 Surface analysis identified the ligand-binding pocket of the thioesterase domain that encompasses the catalytic triad of Ser2308, His2481, Asp2338. Docking of palmitate into this pocket revealed the ligand-binding mode
17687193 Fatty acid synthase [FAS] activity levels were higher in cancer than in the corresponding normal mucosa. Tumors on the left side of the colon showed higher FAS activity; tumors from male patients showed higher activity than tumors from females.
17662476 By using cerulenin and C75, two known inhibitors of FAS we were able to significantly block CVB3 replication.
17631500 the major mechanism of HER2-mediated induction of FASN and ACCalpha in the breast cancer cells used in this study is translational regulation primarily through the mTOR signaling pathway.
17618296 The crystal structure of the thioesterase domain of FAS is determined.
17618104 reduced expression of the fatty acid synthase gene in adipose tissues of obese subjects.
17492427 FASN gene expression in adipose tissue is linked to visceral fat accumulation, impaired insulin sensitivity, increased circulating fasting insulin, IL-6, leptin and RBP4
17488603 FAS protein was expressed in all the three breast cancer cell lines with different levels, but its expression in NIH3T3 was not detected. FAS protein was localized primarily in cytosol.
17188392 HCV-3a core protein has a stronger effect on fatty acid synthase activation in comparison to HCV-1b core, which could contribute to the higher prevalence and severity of steatosis in HCV-3a infections
16894240 thiazolidinediones upregulate the adipocyte lipid storage genes DGAT and FAS but have no significant effect on LPL
16644689 Tamoxifen can modulate appetite through alterations in FAS expression and malonyl-CoA levels suggesting a link between hypothalamic sex steroid receptors, fatty acid metabolism, and feeding behavior.
16582625 Fatty acid synthase (FAS) gene, encoding for a key enzyme involved in the biogenesis of membrane lipids in rapidly proliferating cells, is a conserved target of the p53 family throughout the evolution.
16215233 analysis of human fatty-acid synthase substrate recognition
16175090 increased expression in 7 of 8 patients with invasive Paget's disease of the vulva (PDV), 3 of 4 patients with microinvasive PDV & 1 of 8 patients with noninvasive PDV; statistical analysis revealed increased expression was associated with invasive PDV
15897909 Our results indicate that the specific inhibition of fatty acid synthase (FAS) gene by siRNA leads to apoptosis of prostate tumor cells, and inhibition of PI 3-kinase pathway synergizes with FAS siRNA to enhance tumor cell death.
15669079 FAS blockade should result in a concomitant down-regulation of VEGF
15523670 study reveals for the first time that extracellular acidosis can work in an epigenetic fashion by up-regulating the transcriptional expression of FAS gene
15507492 2.6-A resolution structure
15254710 breast cancer-associated FAS plays an active role in human breast cancer chemosensitivity
15235125 Data suggest that HER2 may act as the key molecular sensor of energy imbalance after the perturbation of tumor-associated fatty acid synthase hyperactivity in cancer cells.
15220220 Val1483Ile substitution in FAS is protective against obesity in Pima Indians, an effect possibly explained by the role of this gene in the regulation of substrate oxidation.
15113941 Regions responsible for hormonal regulation of the FAS gene lie in the proximal portion of the gene's 5'-flanking region, within which we identified an insulin response element.
15047835 cellular FAS activity is important for induction of immediate-early gene BZLF1 transcription from the intact latent EBV genome
14689581 FAS plays in important cellular processes such as apoptosis and proliferation. Because of the frequent overexpression of this enzyme prostate cancer, FAS constitutes a therapeutic target in this disease [review].
12939396 a strong association between FAS expression and prostate tumor initiation and progression
12882974 compelling evidence that human mitochondria contain a malonyl-CoA/acyl carrier protein-dependent fatty acid synthase system
12839976 RNA interference-mediated silencing of this gene attenuates growth and induces morphological changes and apoptosis of prostate cancer cells.
12646257 Data point to a link between fatty acid synthase overexpression and dysregulation of membrane composition and functioning in tumor cells.
12531699 Regulation of fatty acid synthase expression in breast cancer by sterol regulatory element binding protein-1c.
12515624 Fatty acid synthase in the specimens of non-small cell lung cancer patients has no correlation with most clinical factors, except that, in early lesions, it may signify poor prognosis.
12213084 expression of FAS is affected by polyunsaturated fatty acids in human cells
12060737 Domain movements in human fatty acid synthase by quantized elastic deformational model
11790787 regulation of expression by liver X receptors
11756679 We present the first three-dimensional reconstruction of human fatty acid synthase obtained by electron cryomicroscopy and single-particle image processing

AA Sequence

MEEVVIAGMSGKLPESENLQEFWDNLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRFDASFFGVHPK      1 - 70
QAHTMDPQLRLLLEVTYEAIVDGGINPDSLRGTHTGVWVGVSGSETSEALSRDPETLVGYSMVGCQRAMM     71 - 140
ANRLSFFFDFRGPSIALDTACSSSLMALQNAYQAIHSGQCPAAIVGGINVLLKPNTSVQFLRLGMLSPEG    141 - 210
TCKAFDTAGNGYCRSEGVVAVLLTKKSLARRVYATILNAGTNTDGFKEQGVTFPSGDIQEQLIRSLYQSA    211 - 280
GVAPESFEYIEAHGTGTKVGDPQELNGITRALCATRQEPLLIGSTKSNMGHPEPASGLAALAKVLLSLEH    281 - 350
GLWAPNLHFHSPNPEIPALLDGRLQVVDQPLPVRGGNVGINSFGFGGSNVHIILRPNTQPPPAPAPHATL    351 - 420
PRLLRASGRTPEAVQKLLEQGLRHSQDLAFLSMLNDIAAVPATAMPFRGYAVLGGERGGPEVQQVPAGER    421 - 490
PLWFICSGMGTQWRGMGLSLMRLDRFRDSILRSDEAVKPFGLKVSQLLLSTDESTFDDIVHSFVSLTAIQ    491 - 560
IGLIDLLSCMGLRPDGIVGHSLGEVACGYADGCLSQEEAVLAAYWRGQCIKEAHLPPGAMAAVGLSWEEC    561 - 630
KQRCPPGVVPACHNSKDTVTISGPQAPVFEFVEQLRKEGVFAKEVRTGGMAFHSYFMEAIAPPLLQELKK    631 - 700
VIREPKPRSARWLSTSIPEAQWHSSLARTSSAEYNVNNLVSPVLFQEALWHVPEHAVVLEIAPHALLQAV    701 - 770
LKRGLKPSCTIIPLMKKDHRDNLEFFLAGIGRLHLSGIDANPNALFPPVEFPAPRGTPLISPLIKWDHSL    771 - 840
AWDVPAAEDFPNGSGSPSAAIYNIDTSSESPDHYLVDHTLDGRVLFPATGYLSIVWKTLARALGLGVEQL    841 - 910
PVVFEDVVLHQATILPKTGTVSLEVRLLEASRAFEVSENGNLVVSGKVYQWDDPDPRLFDHPESPTPNPT    911 - 980
EPLFLAQAEVYKELRLRGYDYGPHFQGILEASLEGDSGRLLWKDNWVSFMDTMLQMSILGSAKHGLYLPT    981 - 1050
RVTAIHIDPATHRQKLYTLQDKAQVADVVVSRWLRVTVAGGVHISGLHTESAPRRQQEQQVPILEKFCFT   1051 - 1120
PHTEEGCLSERAALQEELQLCKGLVQALQTKVTQQGLKMVVPGLDGAQIPRDPSQQELPRLLSAACRLQL   1121 - 1190
NGNLQLELAQVLAQERPKLPEDPLLSGLLDSPALKACLDTAVENMPSLKMKVVEVLAGHGHLYSRIPGLL   1191 - 1260
SPHPLLQLSYTATDRHPQALEAAQAELQQHDVAQGQWDPADPAPSALGSADLLVCNCAVAALGDPASALS   1261 - 1330
NMVAALREGGFLLLHTLLRGHPLGDIVAFLTSTEPQYGQGILSQDAWESLFSRVSLRLVGLKKSFYGSTL   1331 - 1400
FLCRRPTPQDSPIFLPVDDTSFRWVESLKGILADEDSSRPVWLKAINCATSGVVGLVNCLRREPGGNRLR   1401 - 1470
CVLLSNLSSTSHVPEVDPGSAELQKVLQGDLVMNVYRDGAWGAFRHFLLEEDKPEEPTAHAFVSTLTRGD   1471 - 1540
LSSIRWVCSSLRHAQPTCPGAQLCTVYYASLNFRDIMLATGKLSPDAIPGKWTSQDSLLGMEFSGRDASG   1541 - 1610
KRVMGLVPAKGLATSVLLSPDFLWDVPSNWTLEEAASVPVVYSTAYYALVVRGRVRPGETLLIHSGSGGV   1611 - 1680
GQAAIAIALSLGCRVFTTVGSAEKRAYLQARFPQLDSTSFANSRDTSFEQHVLWHTGGKGVDLVLNSLAE   1681 - 1750
EKLQASVRCLATHGRFLEIGKFDLSQNHPLGMAIFLKNVTFHGVLLDAFFNESSADWREVWALVQAGIRD   1751 - 1820
GVVRPLKCTVFHGAQVEDAFRYMAQGKHIGKVVVQVLAEEPEAVLKGAKPKLMSAISKTFCPAHKSYIIA   1821 - 1890
GGLGGFGLELAQWLIQRGVQKLVLTSRSGIRTGYQAKQVRRWRRQGVQVQVSTSNISSLEGARGLIAEAA   1891 - 1960
QLGPVGGVFNLAVVLRDGLLENQTPEFFQDVCKPKYSGTLNLDRVTREACPELDYFVVFSSVSCGRGNAG   1961 - 2030
QSNYGFANSAMERICEKRRHEGLPGLAVQWGAIGDVGILVETMSTNDTIVSGTLPQRMASCLEVLDLFLN   2031 - 2100
QPHMVLSSFVLAEKAAAYRDRDSQRDLVEAVAHILGIRDLAAVNLDSSLADLGLDSLMSVEVRQTLEREL   2101 - 2170
NLVLSVREVRQLTLRKLQELSSKADEASELACPTPKEDGLAQQQTQLNLRSLLVNPEGPTLMRLNSVQSS   2171 - 2240
ERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYG   2241 - 2310
ACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEH   2311 - 2380
NRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKT   2381 - 2450
GGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG            2451 - 2511
//

Text Mined References (208)

PMID Year Title
27478939 2016 C13orf31 (FAMIN) is a central regulator of immunometabolic function.
26663084 2016 Crystal Structure and Substrate Specificity of Human Thioesterase 2: INSIGHTS INTO THE MOLECULAR BASIS FOR THE MODULATION OF FATTY ACID SYNTHASE.
26514456 2015 Expression of Fatty Acid Synthase Negatively Correlates with PTEN and Predicts Peritoneal Dissemination of Human Gastric Cancer.
26425687 2015 Inhibition of de novo Palmitate Synthesis by Fatty Acid Synthase Induces Apoptosis in Tumor Cells by Remodeling Cell Membranes, Inhibiting Signaling Pathways, and Reprogramming Gene Expression.
26378037 2015 Intracellular activation of EGFR by fatty acid synthase dependent palmitoylation.
26134042 2015 Antitumor effects of a drug combination targeting glycolysis, glutaminolysis and de novo synthesis of fatty acids.
26109148 2016 Loss of fatty acid synthase suppresses the malignant phenotype of colorectal cancer cells by down-regulating energy metabolism and mTOR signaling pathway.
26107737 2015 Dual fatty acid synthase and HER2 signaling blockade shows marked antitumor activity against breast cancer models resistant to anti-HER2 drugs.
26025399 2015 Molecular events are associated with resistance to vinblastine in bladder cancer.
25970773 2015 Increased expression of fatty acid synthase provides a survival advantage to colorectal cancer cells via upregulation of cellular respiration.
25958981 2015 Global gene deregulations in FASN silenced retinoblastoma cancer cells: molecular and clinico-pathological correlations.
25947066 2015 Fatty acid synthase overexpression: target for therapy and reversal of chemoresistance in ovarian cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25871544 2015 Diacylglycerol Metabolism and Signaling Is a Driving Force Underlying FASN Inhibitor Sensitivity in Cancer Cells.
25868764 2015 Association of fatty-acid synthase polymorphisms and expression with outcomes after radical prostatectomy.
25855506 2015 HCBP6 Modulates Triglyceride Homeostasis in Hepatocytes Via the SREBP1c/FASN Pathway.
25674245 2014 Interaction between fatty acid synthase and human epidermal growth receptor 2 (HER2) in osteosarcoma cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25433947 2015 Expressions of fatty acid synthase and HER2 are correlated with poor prognosis of ovarian cancer.
25301948 2014 Crystal structure of the human fatty acid synthase enoyl-acyl carrier protein-reductase domain complexed with triclosan reveals allosteric protein-protein interface inhibition.
25231933 2014 Expression and roles of fatty acid synthase in hepatocellular carcinoma.
25227797 2014 Fatty acid synthesis pathway genetic variants and clinical outcome of non-small cell lung cancer patients after surgery.
25173531 2014 Fatty acid synthase/oxidized low-density lipoprotein as metabolic oncogenes linking obesity to colon cancer via NF-kappa B in Egyptians.
25151963 2015 Fatty acid synthase inhibition engages a novel caspase-2 regulatory mechanism to induce ovarian cancer cell death.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25034529 2014 MicroRNA-142-3p, a novel target of tumor suppressor menin, inhibits osteosarcoma cell proliferation by down-regulation of FASN.
24907642 2014 Novel nuclear localization of fatty acid synthase correlates with prostate cancer aggressiveness.
24789255 2014 Overexpression of fatty acid synthase in human gliomas correlates with the WHO tumor grade and inhibition with Orlistat reduces cell viability and triggers apoptosis.
24696471 2014 Rab18 facilitates dengue virus infection by targeting fatty acid synthase to sites of viral replication.
24596388 2014 Prolyl-isomerase Pin1 impairs trastuzumab sensitivity by up-regulating fatty acid synthase expression.
24520215 2014 Fatty acid synthase mediates the epithelial-mesenchymal transition of breast cancer cells.
24510238 2014 Cancer cell-associated fatty acid synthase activates endothelial cells and promotes angiogenesis in colorectal cancer.
24390663 2014 MicroRNA-320 inhibits osteosarcoma cells proliferation by directly targeting fatty acid synthase.
24366211 2014 Positive feedback regulation between Akt phosphorylation and fatty acid synthase expression in osteosarcoma.
24362464 2014 The fatty acid synthase inhibitor orlistat reduces the growth and metastasis of orthotopic tongue oral squamous cell carcinomas.
24337182 2014 Fatty acid synthase overexpression in adult testicular germ cell tumors: potential role in the progression of non-seminomatous germ cell tumors.
24277691 2014 Influence of breastfeeding on blood-cell transcript-based biomarkers of health in children.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24200503 2014 Fatty acid synthase plays a role in cancer metabolism beyond providing fatty acids for phospholipid synthesis or sustaining elevations in glycolytic activity.
24108439 2014 Elevated fatty acid synthase expression in prostate needle biopsy cores predicts upgraded Gleason score in radical prostatectomy specimens.
24105476 2013 Sterol regulatory element-binding protein-1/fatty acid synthase involvement in proliferation inhibition and apoptosis promotion induced by progesterone in endometrial cancer.
24080588 2014 Molecular mechanisms of fatty acid synthase (FASN)-mediated resistance to anti-cancer treatments.
23982110 2014 Fatty acid synthase expression is strongly related to menopause in early-stage breast cancer patients.
23887214 2013 Evaluation of plasma soluble fatty acid synthase levels among Saudi autistic children. Relation to disease severity.
23725225 2013 Loss of fatty acid synthase inhibits the "HER2-PI3K/Akt axis" activity and malignant phenotype of Caco-2 cells.
23675653 2013 Differential regulation of host genes including hepatic fatty acid synthase in HBV-transgenic mice.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23427160 2013 Hepatitis C virus replication is modulated by the interaction of nonstructural protein NS5B and fatty acid synthase.
23419663 Expression status of fatty acid synthase (FAS) but not HER2 is correlated with the differentiation grade and prognosis of esophageal carcinoma.
23317220 2012 Inhibitory effects of onion (Allium cepa L.) extract on proliferation of cancer cells and adipocytes via inhibiting fatty acid synthase.
23306391 2013 Fatty acid synthase is a potential therapeutic target in estrogen receptor-/progesterone receptor-positive endometrioid endometrial cancer.
23269672 2013 Modulation of fatty acid synthase degradation by concerted action of p38 MAP kinase, E3 ligase COP1, and SH2-tyrosine phosphatase Shp2.
23208675 2013 Fatty acid synthase overexpression confers an independent prognosticator and associates with radiation resistance in nasopharyngeal carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184344 2013 Inhibition of DNA-dependent protein kinase reduced palmitate and oleate-induced lipid accumulation in HepG2 cells.
23142364 2012 Regulation of fatty acid synthase (FAS) and apoptosis in estrogen-receptor positive and negative breast cancer cells by conjugated linoleic acids.
23135268 2012 G protein-coupled estrogen receptor mediates the up-regulation of fatty acid synthase induced by 17?-estradiol in cancer cells and cancer-associated fibroblasts.
23064941 2013 Usefulness of immunohistochemical expression analysis of metabolic-related molecules in differentiating between intracranial neoplastic and non-neoplastic lesions.
23040493 2012 Genome-wide linkage and association analyses implicate FASN in predisposition to Uterine Leiomyomata.
22949843 2012 Combined phosphatase and tensin homolog (PTEN) loss and fatty acid synthase (FAS) overexpression worsens the prognosis of Chinese patients with hepatocellular carcinoma.
22786746 2012 Reduced expression of FASN through SREBP-1 down-regulation is responsible for hypoxic cell death in HepG2 cells.
22771636 Inhibition of fatty acid synthase supresses osteosarcoma cell invasion and migration.
22723001 2012 Fatty acid synthase expression and esophageal cancer.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22653145 2012 Fatty acid synthase expression associated with NAC1 is a potential therapeutic target in ovarian clear cell carcinomas.
22490687 2012 [Effects of soluble epoxide hydrolase inhibitors on the expression of fatty acid synthase in peripheral blood mononuclear cell of patients and inflammatory response with acute coronary syndrome].
22425483 2012 Primary nasal mucosal melanoma in Brazil: clinicopathologic and immunohistochemical study of 12 patients.
22266115 2012 Inhibition of fatty acid synthase attenuates CD44-associated signaling and reduces metastasis in colorectal cancer.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22135723 2011 Immunohistochemical expressions of fatty acid synthase and phosphorylated c-Met in thyroid carcinomas of follicular origin.
22127986 2012 Early growth response 1 and fatty acid synthase expression is altered in tumor adjacent prostate tissue and indicates field cancerization.
21970855 2011 Blockade of fatty acid synthase induces ubiquitination and degradation of phosphoinositide-3-kinase signaling proteins in ovarian cancer.
21922386 2011 Overexpression of fatty acid synthase in human urinary bladder cancer and combined expression of the synthase and Ki-67 as a predictor of prognosis of cancer patients.
21908709 2011 Crystal structure of FAS thioesterase domain with polyunsaturated fatty acyl adduct and inhibition by dihomo-gamma-linolenic acid.
21877200 2012 Soluble fatty acid synthase relates to bone biomarkers in prepubertal children.
21757596 2011 Is there a role for fatty acid synthase in the diagnosis of prostatic adenocarcinoma?: A comparison with AMACR.
21726077 2011 The lipogenesis pathway as a cancer target.
21646813 2011 Interactions between dietary fat intake and FASN genetic variation influence LDL peak particle diameter.
21641044 2011 Val1483Ile polymorphism in the fatty acid synthase gene was associated with depressive symptoms under the influence of psychological stress.
21442130 2011 Overexpression of fatty acid synthase in Middle Eastern epithelial ovarian carcinoma activates AKT and Its inhibition potentiates cisplatin-induced apoptosis.
21325951 2011 Fatty acid synthase expression in Barrett's esophagus: implications for carcinogenesis.
21269460 2011 Initial characterization of the human central proteome.
21044743 2010 Increased fatty acid synthase activity in non-small cell lung cancer tissue is a weaker predictor of shorter patient survival than increased lipoprotein lipase activity.
20965718 2011 Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20811782 2010 Inhibition of insulin and T3-induced fatty acid synthase by hexanoate.
20691427 2010 Genetic associations of brain structural networks in schizophrenia: a preliminary study.
20691246 2010 Down-regulation of the phosphoenolpyruvate carboxykinase gene in human colon tumors and induction by omega-3 fatty acids.
20679621 2010 Fatty acid synthase polymorphisms, tumor expression, body mass index, prostate cancer risk, and survival.
20657182 2010 High levels of fatty acid synthase expression in esophageal cancers represent a potential target for therapy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20606731 2010 Expression of fatty acid synthase in nonalcoholic fatty liver disease.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20546348 2010 Comparison of the diagnostic value of fatty acid synthase (FASN) with alpha-methylacyl-CoA racemase (AMACR) as prostatic cancer tissue marker.
20511185 2010 Fatty acid synthase as a novel target for meningioma therapy.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20356977 2010 Hyperglycaemia confers resistance to chemotherapy on breast cancer cells: the role of fatty acid synthase.
20299470 2010 Extracellular fatty acid synthase: a possible surrogate biomarker of insulin resistance.
20228782 2010 Serous tubal intraepithelial carcinoma upregulates markers associated with high-grade serous carcinomas including Rsf-1 (HBXAP), cyclin E and fatty acid synthase.
20132826 2010 Structure of the human fatty acid synthase KS-MAT didomain as a framework for inhibitor design.
20126469 2010 A mutant of hepatitis B virus X protein (HBxDelta127) promotes cell growth through a positive feedback loop involving 5-lipoxygenase and fatty acid synthase.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20067991 2010 The SDF-1alpha/CXCR4 axis induces the expression of fatty acid synthase via sterol regulatory element-binding protein-1 activation in cancer cells.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19893031 2009 Trophoblastic neoplasms express fatty acid synthase, which may be a therapeutic target via its inhibitor C93.
19885560 2009 Fatty acid synthase activity regulates HER2 extracellular domain shedding into the circulation of HER2-positive metastatic breast cancer patients.
19876008 2010 Effect of genetic variation in the human fatty acid synthase gene (FASN) on obesity and fat depot-specific mRNA expression.
19851294 2009 Decrease in FASN expression in adipose tissue of hypertensive individuals.
19728851 2009 Serum concentrations of extracellular fatty acid synthase in patients with steatohepatitis.
19621387 2010 Sp1 coordinately regulates de novo lipogenesis and proliferation in cancer cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19543203 2010 The gene expression of the main lipogenic enzymes is downregulated in visceral adipose tissue of obese subjects.
19517019 2009 p63 promotes cell survival through fatty acid synthase.
19471962 2009 Evaluation of fatty acid synthase expression in oesophageal mucosa of patients with oesophagitis, Barrett's oesophagus and adenocarcinoma.
19467222 2009 Interaction between fatty acid synthase- and ErbB-systems in ovarian cancer cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19358283 2009 Increased expression of fatty acid synthase in human aberrant crypt foci: possible target for colorectal cancer prevention.
19318631 2009 Fatty acid synthase: a metabolic enzyme and candidate oncogene in prostate cancer.
19300427 2009 Val1483Ile in FASN gene is linked to central obesity and insulin sensitivity in adult white men.
19252981 2009 Genetic variation in genes of the fatty acid synthesis pathway and breast cancer risk.
19083124 2009 Aromatase, CYP1B1 and fatty acid synthase expression in breast tumors of BRCA1 mutation carriers.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19032940 2009 AMPK-sensed cellular energy state regulates the release of extracellular Fatty Acid Synthase.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18955444 2008 Cohort study of fatty acid synthase expression and patient survival in colon cancer.
18838960 2008 Overexpression of fatty acid synthase is associated with palmitoylation of Wnt1 and cytoplasmic stabilization of beta-catenin in prostate cancer.
18830996 2008 Fatty acid synthase is up-regulated during hepatitis C virus infection and regulates hepatitis C virus entry and production.
18820672 2008 Characterization of a novel anti-fatty acid synthase (FASN) antiserum in breast tissue.
18802406 2008 Co-expression of fatty acid synthase and caveolin-1 in pancreatic ductal adenocarcinoma: implications for tumor progression and clinical outcome.
18796435 2008 Inhibition of fatty-acid synthase induces caspase-8-mediated tumor cell apoptosis by up-regulating DDIT4.
18682509 2008 Fatty acid synthase and AKT pathway signaling in a subset of papillary thyroid cancers.
18682402 2008 Proto-oncogene FBI-1 (Pokemon) and SREBP-1 synergistically activate transcription of fatty-acid synthase gene (FASN).
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18635971 2008 Caveolin-1 interacts with a lipid raft-associated population of fatty acid synthase.
18528705 2008 Differential expression of fatty acid synthase (FAS) and ErbB2 in nonmalignant and malignant oral keratinocytes.
18455495 2008 Differential activation of recombinant human acetyl-CoA carboxylases 1 and 2 by citrate.
18420801 2008 Activation of sterol regulatory element-binding protein 1c and fatty acid synthase transcription by hepatitis C virus non-structural protein 2.
18410580 2008 Fatty acid synthase expression in squamous cell carcinoma of the tongue: clinicopathological findings.
18281512 2008 A new mechanism of drug resistance in breast cancer cells: fatty acid synthase overexpression-mediated palmitate overproduction.
18281474 2008 Fatty acid synthase gene is up-regulated by hypoxia via activation of Akt and sterol regulatory element binding protein-1.
18239060 2008 Dietary soy protein inhibits DNA damage and cell survival of colon epithelial cells through attenuated expression of fatty acid synthase.
18211286 2008 Overexpression of fatty acid synthase gene activates HER1/HER2 tyrosine kinase receptors in human breast epithelial cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18022563 2007 Mechanism and substrate recognition of human holo ACP synthase.
17847090 2008 Molecular docking study of the interactions between the thioesterase domain of human fatty acid synthase and its ligands.
17687193 2006 Fatty acid synthase hyperactivation in human colorectal cancer: relationship with tumor side and sex.
17662476 2007 The human fatty acid synthase: a new therapeutic target for coxsackievirus B3-induced diseases?
17631500 2007 Up-regulation of acetyl-CoA carboxylase alpha and fatty acid synthase by human epidermal growth factor receptor 2 at the translational level in breast cancer cells.
17618296 2007 Crystal structure of the thioesterase domain of human fatty acid synthase inhibited by Orlistat.
17618104 2008 The effect of dietary carbohydrate on genes for fatty acid synthase and inflammatory cytokines in adipose tissues from lean and obese subjects.
17492427 2007 Fatty acid synthase gene expression in human adipose tissue: association with obesity and type 2 diabetes.
17488603 2007 [Transcriptional activities of human fatty acid synthase promoter in breast cancer cells].
17220478 2007 Proteomics analysis of the interactome of N-myc downstream regulated gene 1 and its interactions with the androgen response program in prostate cancer cells.
17188392 2007 Up-regulation of fatty acid synthase promoter by hepatitis C virus core protein: genotype-3a core has a stronger effect than genotype-1b core.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16894240 2006 The lipogenic enzymes DGAT1, FAS, and LPL in adipose tissue: effects of obesity, insulin resistance, and TZD treatment.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16644689 2006 Tamoxifen-induced anorexia is associated with fatty acid synthase inhibition in the ventromedial nucleus of the hypothalamus and accumulation of malonyl-CoA.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16582625 2006 The fatty acid synthase gene is a conserved p53 family target from worm to human.
16215233 2005 Substrate recognition by the human fatty-acid synthase.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
16175090 2005 Fatty acid synthase expression in Paget's disease of the vulva.
15897909 2005 FAS expression inversely correlates with PTEN level in prostate cancer and a PI 3-kinase inhibitor synergizes with FAS siRNA to induce apoptosis.
15669079 2005 Does endogenous fatty acid metabolism allow cancer cells to sense hypoxia and mediate hypoxic vasodilatation? Characterization of a novel molecular connection between fatty acid synthase (FAS) and hypoxia-inducible factor-1alpha (HIF-1alpha)-related expression of vascular endothelial growth factor (VEGF) in cancer cells overexpressing her-2/neu oncogene.
15523670 2005 In support of fatty acid synthase (FAS) as a metabolic oncogene: extracellular acidosis acts in an epigenetic fashion activating FAS gene expression in cancer cells.
15507492 2004 Human fatty acid synthase: structure and substrate selectivity of the thioesterase domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15254710 2004 Inhibition of tumor-associated fatty acid synthase activity enhances vinorelbine (Navelbine)-induced cytotoxicity and apoptotic cell death in human breast cancer cells.
15235125 2004 Inhibition of fatty acid synthase (FAS) suppresses HER2/neu (erbB-2) oncogene overexpression in cancer cells.
15220220 2004 A novel missense substitution (Val1483Ile) in the fatty acid synthase gene (FAS) is associated with percentage of body fat and substrate oxidation rates in nondiabetic Pima Indians.
15113941 2004 The human fatty acid synthase gene and de novo lipogenesis are coordinately regulated in human adipose tissue.
15047835 2004 Fatty acid synthase expression is induced by the Epstein-Barr virus immediate-early protein BRLF1 and is required for lytic viral gene expression.
14689581 2004 Fatty acid synthase: a metabolic oncogene in prostate cancer?
12939396 2003 Fatty acid synthase expression defines distinct molecular signatures in prostate cancer.
12882974 2003 Cloning, expression, characterization, and interaction of two components of a human mitochondrial fatty acid synthase. Malonyltransferase and acyl carrier protein.
12839976 2003 RNA interference-mediated silencing of the fatty acid synthase gene attenuates growth and induces morphological changes and apoptosis of LNCaP prostate cancer cells.
12815048 2003 Cloning, expression, and characterization of a human 4'-phosphopantetheinyl transferase with broad substrate specificity.
12689621 2003 Structural and functional organization of the animal fatty acid synthase.
12646257 2003 Fatty acid synthase drives the synthesis of phospholipids partitioning into detergent-resistant membrane microdomains.
12531699 2003 Regulation of fatty acid synthase expression in breast cancer by sterol regulatory element binding protein-1c.
12515624 2002 [Significance of fatty acid synthase expression in non-small cell lung cancer].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213084 2002 Polyunsaturated fatty acids decrease the expression of sterol regulatory element-binding protein-1 in CaCo-2 cells: effect on fatty acid synthesis and triacylglycerol transport.
11790787 2002 Direct and indirect mechanisms for regulation of fatty acid synthase gene expression by liver X receptors.
11756679 2002 Quaternary structure of human fatty acid synthase by electron cryomicroscopy.
11248039 2001 Human fatty acid synthase: role of interdomain in the formation of catalytically active synthase dimer.
11034606 2000 FIST/HIPK3: a Fas/FADD-interacting serine/threonine kinase that induces FADD phosphorylation and inhibits fas-mediated Jun NH(2)-terminal kinase activation.
11018265 2000 Identification of a novel FAS/ER-alpha fusion transcript expressed in human cancer cells.
10769045 2000 Fatty acid synthase is expressed mainly in adult hormone-sensitive cells or cells with high lipid metabolism and in proliferating fetal cells.
9356448 1997 Human fatty acid synthase: assembling recombinant halves of the fatty acid synthase subunit protein reconstitutes enzyme activity.
8986532 1997 Expression of fatty acid synthase is closely linked to proliferation and stromal decidualization in cycling endometrium.
8944226 1996 Biosynthesis of triacylglycerols.
8662758 1996 Human fatty-acid synthase gene. Evidence for the presence of two promoters and their functional interaction.
8022791 1994 Fatty acid synthesis: a potential selective target for antineoplastic therapy.
7835891 1994 Isolation and chromosomal mapping of genomic clones encoding the human fatty acid synthase gene.
7595075 1995 Human fatty acid synthase mRNA: tissue distribution, genetic mapping, and kinetics of decay after glucose deprivation.
7567999 1995 Human fatty acid synthase: properties and molecular cloning.
2669958 1989 Fatty acid synthase, a proficient multifunctional enzyme.
1044453 1975 [Cancer diagnosis of the respiratory system].
600212 1977 [Viscosimetry in clinical practice].