Property Summary

NCBI Gene PubMed Count 568
PubMed Score 3494.04
PubTator Score 2932.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
hepatocellular carcinoma 1.200 1.0e-02
cutaneous lupus erythematosus 1.700 7.7e-03
osteosarcoma -1.526 1.0e-04
tuberculosis and treatment for 6 months -1.600 4.6e-04
psoriasis 1.200 6.4e-32

 GO Function (1)

Protein-protein Interaction (9)

Gene RIF (581)

PMID Text
27117663 FASL, granzyme B, and cytochrome c blood expression reflects breast cancer progression and response to therapy. (Review)
26858129 These results suggested that FAS/FASL polymorphisms might significantly modify SPM risk among patients with SCCHN in a tumor site-specific manner.
26826505 The study identified Fas ligand (FASLG) as the target of let-7e-5p, and FASLG knockdown increased the migration and tube formation of endothelial progenitor cell.
26690594 No mutation or variation could be found in FASL in patients or controls.
26617948 Abnormal Fas/FasL expression in gastric cardia carcinoma and lymph node tissues are involved in carcinogenesis and metastasis of gastric cancer.
26617708 Fas/FasL system and downstream activation of caspases are important mediators of apoptosis and may be involved in the pathogenesis of pulmonary edema in severe P. falciparum malaria patients.
26582200 Data suggest Faim2/LFG (lifeguard protein) protects against FasL-/Fas ligand-induced apoptosis by down-regulating calcium release from endoplasmic reticulum in cortical neurons.
26479732 Advanced glycation end-product induces apoptosis in human retinal cells via promoting mitochondrial dysfunction and activating the Fas-FasL signaling.
26467838 These data indicate that Epstein-Barr virus exosomes derived from EBV-infected cells are taken up by non-infected cells and induce apoptosis via the extrinsic pathway, and that exosomes trigger apoptosis through the FasL pathway.
26429326 No association has been found between FASL promoter polymorphisms and predisposition to HIV infection.
26400345 FASL expression is an independent marker for earlier disease relapse and disease-specific death in oral squamous cell carcinoma.
26374830 In patients with either Crohn's disease or ulcerative colitis, the extent of endothelial FasL expression was elevated in the submucosa and associated with an elevated number of lymphoid follicles.
26359460 Fas Ligand Deficiency Impairs Tumor Immunity by Promoting an Accumulation of Monocytic Myeloid-Derived Suppressor Cells
26345794 The expression of Ki67 and FasL is closely related to the occurrence and development of cervical carcinoma.
26334989 Case Reports: patients with autosomal recessive inheritance of ALPS-FASLG have a severe phenotype and a partial defect in activation-induced cell death in T- and B-cell lines.
26232171 Membrane-bound FasL mediates platelets-induced apoptosis, whereas Bax/Bak signaling is not required but reinforces platelets-induced apoptosis.
26102031 DcR3 enhances ERK1/2 phosphorylation and opposes FasL signaling in pancreatic cancer cells
25990938 There was no correlation between TGF-beta1 levels and HBV load, but there is a positive correlation between sFas levels and HBV load.
25976983 Findings suggest that FAS rs1800682 and FASLG rs763110 variants modulate the risk of recurrence of squamous cell carcinoma of the oropharynx, particularly in patients with HPV16-positive tumors.
25950471 Th1 cells express high level of FAS-ligand (FASL), which interacts with FAS and leads to caspases' cleavage and ultimately to cell death.
25944167 FASL -844 T > C promoter single nucleotide polymorphism is associated with oral cancers.
25745808 that both ADAM10 and ADAM17 are associated with FasL-containing secretory lysosomes.
25596086 FasL -844 SNP is associated with the susceptibility of pulmonary AD in age <60 years people. Fas -1377 SNP may modify the association of FasL -844 SNP with the risk of pulmonary adenocarcinoma.
25529148 High levels of sFasL is associated with rheumatoid arthritis.
25510486 Thymineless death in F10-treated AML cells occurs via lipid raft depletion and Fas/FasL co-localization in the plasma membrane with activation of the extrinsic apoptotic pathway.
25464339 these findings provide novel experimental evidences supporting that VC or/and VE could reduce p,p'-DDT-induced cytotoxicity of HL-7702 cells via the ROS-mediated mitochondrial pathway and NF-kappaB/FasL pathway.
25437350 data indicate upregulation of the sFas/sFasL system in psoriatic patients.
25404054 data show that the expression of CD200R, CD95 and CD95L was influenced by cardiac surgery and imply the role of these membrane molecules in cell regulation-inhibition and apoptosis following cardiac surgery.
25394756 MiR-21 up-regulation mediates glioblastoma cancer stem cells apoptosis and proliferation by targeting FASLG.
25378591 Intestinal expression of Fas and Fas ligand is upregulated by bacterial signaling through TLR4 and TLR5, with activation of Fas modulating intestinal TLR-mediated inflammation.
25366259 Death induced by CD95R/L elimination (DICE) and CD95-mediated apoptosis have opposing roles in eliminating cancer stem cells (CSCs)and non-CSCs.
25333257 High Fas expression promotes chemoresistance in gastrointestinal cancer by up-regulating P-glycoprotein.
25225287 Up-regulation of Fas-L and cell surface localization of FAS induced by PEDF is mediated by p53.
25169582 The T/T genotype and the T allele of the c.-844T>C polymorphism were associated with increased occurrence of keratoconus, while the C allele was associated with decreased keratoconus occurrence.
25078097 Soluble and membrane bound FASL have distinct roles in rheumatoid arthritis fibroblast-like synoviocytes, with sFASL promoting cell proliferation, and mFASL promoting apoptosis.
25059065 soluble apoptosis markers as sFas-L, Caspase-9, Caspase-8 and sCD153 were significantly higher in stage III obesity patients compared obese patients without food allergy
25056888 This work reveals a novel mechanism of memory B cell apoptosis mediated by LPS and HIV through the Fas/FasL pathway.
24924176 Fas/FasL signaling pathway of the lung microenvironment participates in the development of osteosarcoma lung metastases. (Review)
24899502 Coordinated histone H3 methylation and acetylation regulate physiologic and pathologic fas ligand gene expression in human CD4+ T cells.
24821435 miR-21 is involved in MNNG-induced gastric carcinogenesis in vivo and in vitro via FASLG/BTG2 pathway.
24815844 FAS-1377 G and FASL-844 T alleles may be used as low-penetrant risk factors for bladder cancer development in a Turkish population.
24802849 Fas/FasL interaction mediates keratinocyte death in sunitinib-induced hand-foot skin reaction
24729186 High serum Fas ligand levels are associated with disease progression in multiple myeloma.
24690069 FAS A-670G polymorphism is associated with a higher risk for Pre-eclampsia (PE). There was no association between FAS Ligand C-844T polymorphism and PE.
24665877 data indicated a possible linkage between the FAS and FASLG genes and idiopathic azoospermia
24634493 Functional NK cell repertoires are maintained through IL-2Ralpha and Fas ligand.
24619598 meta-analysis suggests that CD95L polymorphism may not be a risk factor contributing to cervical cancer development
24598538 Carriers of the Fas-1377A and the FasL -844C are more susceptible to the majority of cancers than non-carriers. [Meta-analysis]
24561085 Fas-Fas-ligand signal transduction could be inhibited, especially at the stage of caspase-8 activation, thereby establishing a major mechanism for evasion of apoptosis by these tumors
24534457 In CAD patients, FasL in plasma is associated with both apoptotic susceptibility of NK cells and dynamic changes in circulating NK cells. FASL is a soluble marker with possible atheroprotective effects.
24518159 Survival of porcine fibroblasts enhanced by human FasL and dexamethasone-treated human dendritic cells in vitro.
24473454 FasL -844 CC combined with the Fas -1377 G allele is a protective factor against ESCC.
24424626 We investigated the association between common polymorphisms in the genes for FAS and FASL and the risk of late side effects after radiotherapy for prostate cancer.
24408012 there is an association between FASLG T844C polymorphism and susceptibility to breast cancer, especially in Asians
24375196 Fas 1377G > A polymorphism and FasL 844 T > C polymorphism are both not associated with susceptibility to cervical cancer
24347794 Polymorphisms in FAS and FASL genes are not associated with HBV infection in the Brazilian Amazon region.
24335017 Identify a novel mechanism of interaction between TGF-beta1 and miR-21 in the regulation of FasL protein, which is involved in keloid formation.
24291222 First evidence that full length FasL and FasL fragments display selectivity regarding their association with intracellular binding partners.
24289581 In the title.
24265545 Aqueous humor concentrations of the cytokines (IL-1 alpha, IL-1 beta, IL-6, FasL, and TNF- alpha) in patients with open angle glaucoma, were measured using multiplex bead analysis.
24248546 observed that the FAS-1377G/A and FASL-844C/T polymorphisms were associated with breast cancer risk in Chinese but not whites
24228099 FasL-Fas network might play an important role in the molecular mechanisms of angiogenesis prevention of human intervertebral discs.
24184557 FasL and TRAIL are clustered on the exosomal membrane as oligomerized aggregates ready to form death-inducing signaling complex.
24178789 Insulin-sensitive obese individuals had significantly lower Fas and FasL expression than insulin-resistant obese individuals.
24094130 There is an association of the FAS and FASL gene variants in the promoter regions with primary brain tumors in the Turkish population.
24086353 the FASL polymorphism rs763110 is associated with a significantly reduced risk of cancer, especially in Asian populations.
24072745 A prometastatic function for metalloprotease-cleaved CD95L in triple-negative breast cancer.
23991192 results provide the proof of concept for an optimization of FasL-based chimeric proteins for a therapeutic use
23986795 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
23923075 These findings indicate that sFas and sFasL might play a role in intervertebral disc degeneration.
23850805 FAS ligand levels are biomarkers for patients with lymphoproliferation and autoimmune cytopenia.
23847689 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
23846297 Silencing of decoy receptor 3 (DcR3) expression by siRNA in pancreatic carcinoma cells induces Fas ligand-mediated apoptosis in vitro and in vivo.
23790081 Fas ligand correlates with the documented degree of atrial apoptosis and atrial fibrosis in right atrial appendage tissue after cardiac surgery.
23742646 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
23697029 Semiquantitative analysis of the pattern and distribution of the Fas antigen and Fas Ligand as indicators for hepatic apoptosis was studied and assessed.
23682624 FasL serum levels are not markedly affected in patients with familial Mediterranean fever (FMF) and cannot be used as a supportive marker to differentiate FMF attacks from attack-free periods.
23681795 there were no associations of CD95 A670G and CD95L T844C polymorphisms with gastric cancer
23618817 FASL-844T>C polymorphism is associated with risk of laryngeal and hypopharyngeal squamous cell carcinoma.
23582102 This is the first study presenting sFas and FasL concentrations in early second-trimester amniotic fluid in appropriate for gestational age , small for gestational age, and large for gestational age fetuses.
23560484 Data indicate that FAS-1377G/A and FASLG-844 T/C genotypes are likely to play a substantial role in HBV infection, and FAS-670 polymorphism is associated with chronic HBV infection, while FASLG IVS2nt-124 A/G polymorphism is not.
23534738 The results suggest that FasL is a mediator of immune privilege in oral squamous cell carcinoma and may serve as a marker for predicting malignant change in oral tissues.
23504349 In esophageal squamous cell carcinoma miR-21 expression is increased. miR-21 down-regulation inhibits cell growth, invasion and induces cells to apoptosis by targeting FASL, TIMP3 and RECK genes.
23420824 Suggest that the FAS-L gene polymorphism is associated with RPL in Brazilian women and that these women also have impaired FAS-FAS-L systems due to abnormal FAS-L expression.
23405244 High serum FasL expression is associated with hepatic fibrosis in Nonalcoholic Fatty Liver Disease.
23392773 genotype distributions and allele frequencies of fas ligand did not differ between patients with knee osteoarthritis and controls.
23364796 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
23330016 Tregs, but not Th17 cells, become apoptotic through Fas/FasL pathway, which contributed to reduction of Tregs leading to an imbalance between Th17 and Treg cells.
23285481 In 101 rheumatoid arthritis patients vs 105 controls, there was no significant difference in Fas-670 A/G genotype distribution or allele frequency, there was a correlation with anti-CCP antibody synthesis & anemia.
23280017 expression of Survivin was negatively correlated with that of Fas (r = -0.517, p < 0.01), but positively correlated with that of FasL (r = 0.381, p < 0.01) in tissues of cervical cancer
23269121 Suggest the involvement of the CD95/CD95L pathway in phagocytosis-induced cell death of monocytes and provide evidence that diminished CD95L secretion by cord blood monocytes may result in prolonged activation of neonatal immune effector cells.
23234803 Functional polymorphisms in the Fas and FasL genes may be involved in epithelial ovarian cancer development and progression in northern Chinese women.
23192951 FasL and ADAM10 play an important role in the production of pro-inflammatory cytokines coming from interaction of the intervertebral nucleus pulposus cells and macrophages in co-culture
23184030 Soluble CD95L serum levels are elevated during the subacute and intermediate phases of spinal cord injury.
23177026 Decreased Fas/FasL signaling mediates miR-21-induced chemoresistance in pancreatic cancer.
23153021 FAS -1377 GA genotype appeared to marginally increase the risk while FASL -844 TC genotype appeared as low risk factor.
23076876 study demonstrates that the HeLa cervical cancer cell line expresses CRH; additionally, CRH was shown to induce FasL expression
23065018 In keratoconus, corneal epithelium with higher expression of FasL may evoke apoptosis in keratocytes, while neprilysin could prevent possible rescue of keratocytes from apoptosis.
23045958 FasL was expressed more strongly in moderately and poorly differentiated cutaneous squamous cell carcinoma tumors.
22946667 findings suggest that the FasL -843C/T and VDR FokI gene polymorphisms are associated with type 1 diabetes in the Agean region of Turkey.
22942752 during spontaneous miscarriages, the increased FasL-expressing population could be a part of an M1 phenotype participating in Fas/FasL-related apoptosis.
22942738 data strongly indicate that the inhibition of ceramide conversion to complex sphingolipids by D609 is accompanied by an enhancement of FasL-induced caspase-dependent and -independent cell death in T lymphocytes.
22927007 These experiments further define the molecular mechanism of estrogen's bone-protective effects by inducing osteoclast apoptosis through upregulation of MMP3 and FasL cleavage.
22860894 Genetic polymorphisms of .... fas ligand are associated with clinical efficacy and/or acute severe infusion reactions to infliximab in Crohn's disease.
22842170 presence of strong myoepithelial expression of Fas and simultaneous cytoplasmic and nuclear expression of FasL in epithelial cells could be suggestive as an early predictive factor or signal for onset of breast cancer
22821704 Non-small-cell lung cancer patients carrying XRCC1 Arg194Arg, FAS-1377GG, and FASL-844T allele displayed completely no response to platinum based drugs.
22763913 The aberrant expression of corticotropin-releasing hormone in pre-eclampsia may activate the FasL-positive decidual macrophages, impair the physiological turnover of extravillous trophoblasts, and eventually disturb placentation.
22732091 the FASL-844 CC genotype and C allele seem to be associated with a good prognosis in patients with diagnosis age </= 50 years.
22726303 Plasma concentrations of Fas receptors and Fas ligands tend to be higher in HIV-positive patients.
22706245 levels of serum Fas and FasL in schizophrenic patients
22702044 Dexamethasone upregulates the apoptotic gene expression of Fas/FasL in human articular chondrocytes.
22645131 Data indicate that oligomerization of CD95L has no major effect on CD95 occupancy.
22631677 meta-analysis indicated that FAS -1377G>A and FASL -844T>C polymorphisms might be associated with gastric cancer risk.
22609371 In summary, the Fas/FasL pathway involved in alveolar epithelial cell apoptosis could be important in the pathogenesis of seawater-induced acute lung injury
22535954 Fas ligand enhances malignant behavior of tumor cells through interaction with Met, hepatocyte growth factor receptor, in lipid rafts.
22499988 Fas has a pro-apoptotic role in photoreceptors. Under light stress, soluble and membrane-bound FasL can bind to Fas, inducing apoptosis via a paracrine mechanism
22461695 Decitabine and vorinostat cooperate to sensitize colon carcinoma cells to Fas ligand-induced apoptosis in vitro and tumor suppression in vivo
22449797 NK cell induction of hepatic stellate cell apoptosis in HCV infection was contact dependent and could partly be blocked by antibodies specific for TRAIL, NKG2D and FasL.
22344564 the Fas and Fas-L mRNA expression levels in BGSCs were lower compared to those in primary cultured glioma cells
22341864 Our results suggest that the chromatinization status of the FasL promoter may function as a molecular switch, controlling cAMP and glucocorticoid responsiveness in t-cells
22331638 We provide the first direct evidence that massive liver cell death can be caused by Fas/Fas ligand (FasL) interaction provided by natural killer cells activated by dendritic cells.
22330070 AMPK regulates expression of FASL and COX-2 via the protein kinase C theta - dependent pathway in activated Jurkat cells.
22211869 Results indicate that FAS-FASL-CASP8 polymorphisms contributed to a reduced risk of childhood lymphoblastic leukemia (ALL) in Chinese population.
22207003 Apoptosis markers sFas, FasL or sFas/FasL ratio are associated with high sequential organ failure assessment score (SOFA) in bacteremia.
22199323 CD95-ligand may have a role in recurrence in patients with synchronous colorectal liver metastases
22182632 primary liver disease could influence the pre-transplantation levels of sCD86 and sCD95L. High pre-transplantation serum levels of sCD86 could favor the development of episodes of acute rejection.
22172872 Report high expression of Fas ligand on cord blood dendritic cells which may reduce severity of graft-versus-host disease after cord blood transplantation.
22161157 High expression of FasL is associated with ovarian epithelial tumors.
22153754 Data indicate that lower values of neutrophil/lymphocyte ratio (NLR) and Fas ligand (FasL) expression in late-recurrence compared with other metastatic timings suggest strong host immune activity, and may imply relatively long survival.
22099756 FasL and HO-1 overexpression have beneficial effects in pancreatic islet transplantation
22027769 Abnormal expression of Fas/FasL and increased apoptosis of tumor infiltrating dendritic cells in endometrioid adenocarcinoma may lead to tumor immune escape.
21955608 Administration of prostaglandin I2 has proapoptotic effects in pulmonary artery smooth cells, resulting in Fas ligand upregulation.
21940365 Functional polymorphisms in the apoptotic pathway genes FAS and FASL may significantly contribute to the occurrence of gastric cardia adenocarcinoma.
21910009 Fas and FasL mediated alveolar macrophage apoptosis in human silicosis.
21909273 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
21879377 Apoptosis-related gene Fas (CD95) and FasL (CD178) polymorphisms in Iranian rheumatoid arthritis patients are more frequent than in controls, although this is not statistically significant.
21864851 No statistical association is found between the Fas, FasL and TRAIL polymorphisms and the risk of multiple sclerosis in Iranian patients.
21864388 FASL 844T>C (rs763110)did not find any significant associations for all polymorphisms in relation to gastric cancer and high risk atrophic gastritis.
21808135 Downregulation of Fas receptor and up-regulation of Fas ligand appear to be an important feature of tobacco-related intraoral carcinoma.
21807637 FasL -844T/C polymorphism may predict survival and relapse in NSCLC.
21806408 The polymorphisms of FAS and FASL may be associated with the presence and severity of lumbar disc degeneration in Chinese Han population.
21746966 Foxp3 negatively regulates CD95L expression in Tregs and demonstrates that Tregs are susceptible to homeostatic control by CD95 stimulation.
21729539 The activation of Fas/FasL pathway may play an important role in the K562 cell apoptosis induced by diallyl disulfide.
21725926 Increased apoptosis and the expression of FasL, Bax and caspase-3 in human lupus nephritis suggest that apoptosis might be induced through pathways of these proteins in the pathogenesis process.
21695404 The levels of serum insulin, sFas were raised and sFas-L were decreased significantly in type 2 diabetes subjects than healthy.
21691772 This study determines if Fas/FasL regulates E. coli-induced human monocyte line U937 cell apoptosis.
21605112 activation of FasL is dependent on glucuronoxylomannan interaction with FcgammaRIIB;results highlight a fast track to FasL up-regulation via FcgammaRIIB and assign to this receptor an anti-inflammatory role that also accounts for induced peripheral tolerance
21528407 soluble FasL positivity was associated with a favorable outcome in acute lymphoblastic leukemia patients.
21516345 The aim of this study was to evaluate serum concentrations of sFas, sFasL, and their potential regulators (MMP-2, MMP-7, MMP-9, TIMP-1, TIMP-2), in children and young adults chronically dialyzed.
21466843 Celastrol can induce apoptosis of human non-small-cell lung cancer A549 cells through activation of both mitochondria- and Fas/FasL-mediated pathways.
21368861 The processing of human Fas Lignad protein by ADAM10, but not by SPPL2a, counteracts FasL-mediated apoptosis.
21354149 Post-translational modifications (S-nitrosylation of cysteine residues 199 and 304) in the cytoplasmic domain of Fas promotes fas ligand-mediated apoptosis in cancer cells.
21286777 polymorphisms of FAS LG, FAS promoter and TP53 may have a role in increased risk of coronary artery disease progression
21285513 FasL activity in human and mouse lungs is determined by the structure of its stalk region
21271302 Low expression of Fas and high expression of FasL are more often in colon tumor stage D and in liver metastasis
21270445 Deficiency of SATB1 expression in Sezary cells causes apoptosis resistance by regulating FasL/CD95L transcription.
21227011 This study compared concentrations of three cytokines (interferon-gamma and interleukin [IL]-2 and -4) and soluble Fas ligand in serum and pleural effusions from 36 patients with tuberculous pleurisy, 30 with malignant pleurisy and 30 healthy volunteers.
21159039 results suggest that matrix metalloproteinase 9 (MMP-9) secreted by trophoblasts contributes to endothelial apoptosis via extracellular release of soluble Fas Ligand
21152963 data indicate that membrane expression of FasL and its interaction with its counterpart may contribute to the inflammatory activation of macrophages during immune reactions or pathogenesis of chronic inflammatory diseases
21122378 The FasL expression of human colon cancer cells may be regulated by endogenous interleukin-18 in the host microenvironment and enhance the liver colonization competence of colon cancer cells through induction of apoptosis in Fas-expressing hepatocytes.
21107701 Individually expressed HSV-1 R1 (ICP6) shares, with HSV-2 R1, the ability to bind caspase-8 and to protect cells against death receptor-induced apoptosis.
21087335 Both Fas (cytoplasm and membrane) and FasL were significantly upregulated in syncytiotrophoblast of molar pregnancy.
20959405 Observational study of gene-disease association. (HuGE Navigator)
20842669 Polymorphisms of FASL is associated with nasopharyngeal carcinoma.
20842669 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20726934 is a trend toward Fas-L being more prevalent in the epidermis of drug maculopapular rashes than in non-drug-induced maculopapular rashes
20675370 FasL mRNA forms a complex with the RNA-binding protein HuR both in vitro and ex vivo.
20673483 Results suggest that Jurkat cells might decrease the survival rates of A549 cells and enhanced its apoptosis and immune evasion partly via Fas/FasL pathway.
20650551 None of the polymorphisms analyzed influenced disease susceptibility and/or activity, but a high intake of total, saturated and monounsaturated fats and a higher ratio of n-6/n-3 polyunsaturated fatty acids, was associated with a more active phenotype.
20650551 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20624652 chronic disordered epithelial expression of MMP-7 in patients with asthma might increase mFasL cleavage and contribute to airway epithelial damage and inflammation.
20618494 FAS status and macrophage number and between FASL status and lymphocyte number in skin metastasis but not in primary lesions might point to diverse FAS/FASL interaction between neoplastic cells and macrophages in the different microenvironments
20602615 Observational study of gene-disease association. (HuGE Navigator)
20572163 Functional polymorphism in cell death pathway FASL gene and risk of renal cell carcinoma are reported.
20572163 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20533543 Extracellular calreticulin is present in the joints of patients with rheumatoid arthritis and inhibits FasL (CD95ligand)-mediated apoptosis of T cells
20501759 Results suggest a modestly increased risk for SPM after index SCCHN with FAS -670 A > G and FASLG -844 C > T polymorphisms and an even greater risk for SPM with multiple combined FAS and FASLG risk genotypes.
20501759 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20438363 FASL polymorphisms are not associated with acute myeloid leukemia risk in Koreans.
20438363 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20408337 REVIEW: consequences of dysregulated Fas- and FasL-mediated apoptosis leads to self-reactivity, malignant transformation, and immune dysfunction.
20406899 down-regulating FasL expression and/or function in glial malignancies can enhance T-cell tumor infiltration and inhibit tumor growth
20394629 the presence in individuals of two at-risk alleles of the three FAS/FASLG polymorphisms was associated with a lower risk of alopecia areata (adjusted OR 0.21; 95% CI 0.05-0.89) when compared with the presence of six at-risk alleles.
20394629 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20393600 Acrolein triggers the death receptor pathway of apoptosis, causing elevation of Fas ligand (FasL) and translocation of adaptor protein Fas-associated death domain to the plasma membrane.
20385987 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379197 Mutant PIK3CA interferes with apoptosis downstream of death receptor-signal complex, allowing caspase-8 activation without apoptosis. Cleavage of ROCK-1 by caspase-8 triggers amoeboid shape and invasiveness of HCT116 cells in response to TRAIL and CD95L.
20378615 Observational study of gene-disease association. (HuGE Navigator)
20371612 Foxo3a is able to up-regulate FasL expression through down-regulating miR-21
20359312 FAS polymorphisms not significantly correlated with OSCC development or malignant potential of OL.
20359312 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20353032 Psoralen and ultraviolet A upregulated Fas expression and downregulated FasL expression in NB4 leukemic cells, which induced apoptosis.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20222173 Abnormal Fas and FasL expressions in gastric carcinoma and lymph node tissues are involved in carcinogenesis and metastasis of gastric cancer.
20219325 Observational study of gene-disease association. (HuGE Navigator)
20204402 Observational study of gene-disease association. (HuGE Navigator)
20193111 Up-regulation of FasL expression and decrease of TIL apoptosis in Epstein-Barr virus-associated gastric carcinoma may facilitate the escape of tumor cells from the host immunosurveillance.
20165911 Quantitative RQ-PCR demonstrated that the expression of FasL mRNA in sperm from the varicocele group was higher than in the control group.
20150914 HSF-1 associates with heat shock elements in a cooperative manner to mediate optimal FasL promoter activity
20106900 Observational study of gene-disease association. (HuGE Navigator)
20101459 67LR induces FasL expression and cytotoxicity against Fas-sensitive Jurkat T cells in human cholangiocarcinoma cells through the phosphorylation of c-Myc on Ser-62 and the subsequent activation of the FasL promoter through the ERK pathway
20074157 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20013612 FasL expression may be prognostically significant in thyroid papillary microcarcinoma , suggesting that this counterattack could confer a survival advantage to the malignant cell during the course of cancer progression.
20012528 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
19960225 Connexin32 hemichannels contribute to the apoptotic-to-necrotic transition during Fas-mediated hepatocyte cell death
19941645 Observational study of gene-disease association. (HuGE Navigator)
19937732 Phospholipase A(2) (PLA(2)) from Naja naja atra venom increased Fas and FasL protein expression in human leukemia K562 cells
19926197 IVS2nt 124 G variant not associated with pre-eclampsia
19926197 Observational study of gene-disease association. (HuGE Navigator)
19890662 Observational study of gene-disease association. (HuGE Navigator)
19854829 Data demonstrate that XIAP antagonists in combination with Fas ligand (FasL) or the death receptor 5 (DR5) agonist antibody synergistically stimulate death in cancer cells and inhibit tumor growth.
19826071 the importance of Fas/FasL-mediated apoptosis in lymph node homeostasis
19812265 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
19810143 Downregulation of Fas expression in keratinocytes and lymphocytes of oral lichen planus specimens, together with upregulation of FasL, may serve as initial prognostic biomarker in oral cancer development.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19779494 Altogether, our data show that SMS1 is a novel caspase target that is functionally involved in the regulation of FasL-induced apoptosis.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19641134 When the signal is mediated by full-length membrane-bound FasL, serine-threonine kinase RIP1 is likely a more integral part of physiological signaling through the Fas/CD95 receptor complex than previously recognized.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19614955 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19572057 Helicobacter pylori increases expression of proapoptotic markers Fas and FasL on CD4 lymphocytes in children.
19565204 FAS and FASLG polymorphisms may not contribute to risk of gastric cancer in the southern Chinese population.
19565204 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19542541 Observational study of gene-disease association. (HuGE Navigator)
19538867 Genetic polymorphisms of Fas and FasL in apoptotic pathway are associated with the risk of development of cervical carcinoma.
19538867 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19535642 In a human model of graft-versus-host disease, actively dividing subsets of alloreacting T cells are efficiently (>93%) reduced by soluble FasL treatment during mixed lymphocyte reactions (MLR).
19531476 the Fas ligand (FasL)-activated apoptotic pathway mediates cytotoxicity in stem cells
19527514 Observational study of gene-disease association. (HuGE Navigator)
19505222 high levels of soluble Fas ligand and tumor necrosis factor-alpha are associated with ALF
19458913 The distribution and regional location of Fas and FasL in gastric epithelial cells, gastric carcinoma cells, normal gastric stroma-infiltrating lymphoid cells and tumour-infiltrating lymphoid cells in human gastric carcinoma, was studied.
19434529 The expression enhancement of intracellular FasL in rectal carcinoma in hypoxia can lead to accelerated proliferation and reduced apoptosis of cells.
19403301 meta-analysis suggests that the FASLG -844T/C polymorphism is associated with cancer risk and the -844C allele is a low-penetrant risk factor for cancer development.
19403301 Meta-analysis of gene-disease association. (HuGE Navigator)
19390575 Observational study of gene-disease association. (HuGE Navigator)
19337311 the FASL rs763110 T allele has a possible protective effect on cancer risk
19337311 Meta-analysis of gene-disease association. (HuGE Navigator)
19332441 The data presented here stress the importance of the Fas/FasL system for signal initiation via the TCR-CD3 complex and provide further arguments for a retrograde signaling capacity of FasL or a crucial role of Fas as a co-stimulatory molecule.
19305072 FasL induced apoptosis and cell cycle arrest pituitary adenoma
19266094 MMP7 is related to the acquisition of oxaliplatin-resistance and its inhibition restores drug sensitivity by increasing Fas receptor.
19244619 A non-apoptotic role for Fas/FasL in erythropoiesis is reported.
19240174 Polymorphisms in the FASL is associated with early stage non-small cell lung cancer.
19240174 Observational study of gene-disease association. (HuGE Navigator)
19219602 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19183163 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19181929 active systemic lupus erythematosus is strongly associated with detectable serum levels of sFasL
19176318 Determination of the FAS-L represents, together with the IL-10 concentration and the double negative CD8-CD4 T cell percentage, a reliable tool for the diagnosis of ALPS.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19155494 Regulatory T cells (Treg) from head and neck cancer patients express CD95 ligand (CD95L), up-regulate CD95 and CD95L expression, and suppress CD8-positive responder cell proliferation by inducing Fas-mediated apoptosis.
19146781 FASLG -844C/T SNP may be a genetic predisposing factor of idiopathic azoospermia or severe oligozoospermia among Han Chinese men.
19146781 Observational study of gene-disease association. (HuGE Navigator)
19141860 Observational study of gene-disease association. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
19079288 the activation-induced degranulation of Fas ligand has distinct requirements and involves different mechanisms than those of the granule markers CD63 and CD107a/Lamp-1
19052714 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19041431 several members of the PCH proteins interact with the proline-rich region of Fas ligand (FasL, CD95L), a key death factor in immune cells.
19019335 Observational study of gene-disease association. (HuGE Navigator)
19015953 High FASL is associated with breast ductal carcinoma.
19010354 high expression in PBLs and injured synovia of rheumatoid arthritis patients
19009351 SBDS loss results in abnormal accumulation of Fas at the plasma membrane, where it sensitizes the cells to stimulation by Fas ligand
18854777 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18844072 The expression rate of FasL on T cell subsets in idiopathic thrombocytopenic purpura patients was significantly increased.
18835034 Plasminogen activator inhibitor-1 protects endothelial cells from FasL-mediated apoptosis.
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18813857 Immunohistochemistry using antibodies to determine the protein expression of Fas, Fas-L, Bax, Bcl-2, p53 and c-Myc in skin of venous ulcer patients.
18800686 Laryngocarcinoma cells could induce apoptosis of T lymphocytes through the Fas-FasL system.
18789888 These data reveal that Grb2 facilitates the association of FasL with adaptin beta, and promotes sorting of FasL to the cell surface.
18757527 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18727868 SOD coenzyme can effectively regulate Fas/FasL signal transduction and block apoptosis of alveolar macrophages from pneumoconiosis patients.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18666137 To test whether polymorphisms in IL-1, NF-KB, FAS, and FASL genes are associated with risk of silicosis
18666137 Observational study of gene-disease association. (HuGE Navigator)
18577653 The SNP rs.3830150 A/G showed a significant strong inverse association with SJS/TEN. Analysis of the genotype pattern of SNPs rs.3830150 and rs.2639614 (rs.3830150 A/A-rs.2639614 G/G) also manifested a strong inverse association with SJS/TEN.
18577653 Observational study of gene-disease association. (HuGE Navigator)
18567840 Dendritic cells overexpressing CD95L promote tumor rejection involving neutrophil-mediated innate immunity and CD8(+) T cell-dependent adaptative immune responses
18561948 The proportion of apoptotic CD8+ T cells was inversely correlated with serum levels of soluble Fas ligand in gastric cancer.
18548110 Observational study of gene-disease association. (HuGE Navigator)
18541195 in cultured endothelial cells, endothelial cell-derived microparticles and soluble Fas Ligand were significant factors in Ang-2(angiopoietin 2) elevation
18509086 preventing autocrine CD95L signaling by c-FLIP facilitates T-cell effector function and an efficient immune response
18505906 Fas ligand appear to be differentially expressed on peripheral lymphocytes in the two opposite phenotypes of autoimmune thyroid disease.
18501631 N-terminal truncated product either with or without N-linked carbohydrate chain exhibited the specific binding activity toward soluble human Fas receptor extracellular domain-human IgG(1)-Fc domain fusion protein
18483392 genetic variations in the death pathway genes FasL and CASP8 are involved in susceptibility to developing pancreatic cancer.
18483392 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18473402 Gastrin and somatostatin play important roles in the regulation and control of cell apoptosis in large intestinal carcinoma, and the mechanism may be directly related to the aberrant expression of Fas and Fas ligand.
18427836 These results show that the Fas/FasL-system mediated by caspase-3 activation plays a role in Clonorchis sinensis-infected hepatocyte apoptosis.
18422813 placental FasL expression was significantly lower in abnormal pregnancies than in normal ones
18392917 Nucleus pulposus cells showed strong positive staining for FasLigand in all specimens examined. Quantitative examination demonstrated a significant decrease in FasL expression in the degenerated discs
18383830 FAS and FASL genotypes of the hosts are important determinants in the pathogenesis of gastric atrophy and intestinal metaplasia in H. pylori-infected individuals.
18383830 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18374107 Overexpression of human FasL in pig islets inhibits CTL cytotoxic T cell xenocytotoxicity.
18361934 Observational study of gene-disease association. (HuGE Navigator)
18359029 Soluble Fas ligand plasma levels are associated with forearm reactive hyperemia in subjects with coronary artery disease
18324486 Our findings suggest that the changes in the expression of apoptotic proteins (Fas/FasL and caspase 8) in the thyroid gland of patients with autoimmune Graves Disease and Hashimoto's thyroiditis reflect their involvemetn in the pathogenesis.
18316328 data suggest that there is a different regulation and function of the Fas/FasL system in early human pregnancies.
18314443 primary SzS lymphocytes reveal frequent resistance to apoptosis induced by FasL and TRAIL
18302883 FAS-1377, FAS-670 and FASL-844 polymorphisms are not susceptible factors of silicosis.
18302883 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18292515 The majority of memory CD8+ T cells in FasL transgenic mice display an effector memory phenotype in the long term, in comparison with the mainly central memory phenotype displayed by memory CD8+ T cells in wild type mice.
18220834 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
18217400 in HCV and HIV infections, the concentration of sFas, but not sFasL, in serum correlates with the concentration of ssDNA in liver tissue
18174230 Observational study of gene-disease association. (HuGE Navigator)
18162459 In thyroid glands of patients with Graves disease the regulation of Fas/Fas ligand/Bcl-2 favors apoptosis of infiltrating lymphocytes.
18078642 Soluble Fas and soluble Fas ligand are increased in the joints of patients with rheumatoid arthritis and osteoarthritis.
18076022 The death receptor pathway was activated by the expression of Fas ligand (FasL) or addition of TNF-related apoptosis-inducing ligand (TRAIL) in the presence or absence of proteasome inhibitors.
18069935 Observational study of gene-disease association. (HuGE Navigator)
18068525 Observational study of gene-disease association. (HuGE Navigator)
18068525 There was no significant association between an increased risk of cervical cancer and polymorphisms of the death pathway genes FAS and FASL.
18057579 lower level of soluble Fas may provide proper microenvironment for increased apoptosis of trabecular meshwork cells in primary open angle glaucoma
18050226 The increased apoptosis of peripheral blood lymphocytes from adult-onset Still's disease patients may be associated with the effect of IL-18 through up-regulation of FasL and p53 transcripts.
18045865 CD95L-induced endosomal acidification, ceramide formation, and downstream events, such as p47(phox) phosphorylation, ROS formation, CD95 activation, and apoptosis.
18000680 Tumor production of Fas-L may represent an attempt to destroy the host's lymphocytic reaction.
18000680 Observational study of gene-disease association. (HuGE Navigator)
17997887 FAS-1377G > A, FAS-670A > G and FASL-844T > C gene polymorphisms may not be associated with the susceptibility of coal worker's pneumoconiosis in Han nationality.
17997887 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17969524 FasL and ICAM-1 expression in the tonsillar high endothelial venules contribute to idiopathic tonsillar hypertrophy and chronic hypertrophic tonsillitis.
17966039 regulation of FasL in SS patients with EEG may be due to transcriptional regulation, and the point mutation at - 259T/C in the FasL gene promoter region may lead to the down-regulation of FasL mRNA expression observed in SS patients with EEG.
17962219 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17962219 the risk of breast cancer may be elevated among women with polymorphisms in the FAS gene but not FAS ligand and detectable PAH-DNA adducts.
17961631 The high numbers of tumor-infiltrating lymphocytes in tumors with high levels of microsatellite instability may be due to failure to up-regulate FasL.
17943461 The expression of Fas ligand in the myocardium, as identified in HIV-positive patients, might increase the susceptibility to HAART-induced cardiomyopathy
17941899 Paeoniflorin inhibits A549 cell proliferation via Fas/FasL apoptosic pathway.
17938571 Observational study of gene-disease association. (HuGE Navigator)
17938571 no significant associations found between Fas or FasL promoter polymorphism with hepatitis B virus clearance & HBeAg clearance
17916181 data demonstrated that the progression of TGCT is associated with the increased expression of FasL and a concomitant reduction of Fas
17912957 Allografted cells undergo Fas-mediated apoptosis induced by CD8+ T cells. Our objective was to prevent human keratinocytes from immunologically induced apoptosis by blocking the Fas ligand/Fas interaction.
17853317 A higher expression of apoptotic molecules (Fas and FasL) on lymphocytes occurs before the onset of acute ischaemia and contributes to the plaque rupture and acute coronary syndrome.
17823283 FasL expression on APCs and phagocytosis of apoptotic T cells by FasL(+) KCs are indicators of rejection activity in human liver allografts.
17762757 Observational study of gene-disease association. (HuGE Navigator)
17762757 The FAS-1377, FAS-670, and FASL-844 polymorphisms were not found to be markers of melanoma risk.
17727731 Observational study of gene-disease association. (HuGE Navigator)
17704746 Serum level of FASL was determined during chemotherapy of lung neoplasms.
17704118 Abortion is associated with increased expression of FasL in decidual leukocytes.
17703232 Variants of human TRAIL (hTRAIL) and human CD95L (hCD95L), encompassing the TNF homology domain (THD), interact with the corresponding receptors and stimulate CD95 and TRAILR2 signaling after cross-linking.
17688234 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17667919 FasL expression was associated with higher tumour stage.
17654480 The amount of CaM recruited into the DISC was increased after Fas-stimulation, a finding confirmed by immunofluorescent analysis that demonstrated increased membrane co-localization of CaM and Fas upon Fas-stimulation.
17605793 heterozygous human FasL mutation can dominantly interfere with normal FasL apoptotic function and lead to an ALPS phenotype, designated Type Ib
17598974 Observational study of gene-disease association. (HuGE Navigator)
17598974 Fas/FasL gene polymorphysms are possible that different mechanisms function in apoptosis balance in papillary thyroid cancer development
17564320 The serum levels of soluble FASL were studied in patients with multiple organ failure with complicating peritonitis.
17559541 The frequent expression and coexpression of Fas, FasL and c-FLIP in colorectal carcinoma implicates c-FLIP as an inhibitor of the Fas-FasL-induced death pathway in these tumours.
17557115 ADAM10 and SPPL2a were identified as two proteases implicated in FasL processing and release of the FasL intracellular domain, which has been shown to be important for retrograde FasL signaling
17545588 Germ-line functional polymorphisms affecting either the levels of expression or the biological activity of both Fas and FasL genes could be contributing to the genetic risk to develop T-cell lymphoblastic lymphomas.
17491259 Observational study of gene-disease association. (HuGE Navigator)
17465232 Observational study of gene-disease association. (HuGE Navigator)
17465232 FasL CC genotype was found to increase the risk of ovarian carcinoma and a protective effect of the GGCT genotype was observed
17381722 Observational study of gene-disease association. (HuGE Navigator)
17381722 results indicate that the -844C > T polymorphism is not related with the susceptibility to hepatitis C virus infection, the severity of liver damage and the progression of fibrosis in our cohort of Spanish patients
17290285 These findings suggest that ADAM10 represents an important molecular modulator of FasL-mediated cell death.
17198275 Observational study of genotype prevalence. (HuGE Navigator)
17183065 Observational study of gene-disease association. (HuGE Navigator)
17183065 These findings indicate that functional polymorphisms in FAS and FASL contribute to increased apoptosis of tumor infiltration lymphocytes and risk of breast cancer.
17173971 Treatment with oleandrin facilitated nuclear translocation of FKHR in human, but not murine cells by dephosphorylating Akt.
17164290 phosphorylation and ubiquitin signals regulate the sorting of FasL to secretory lysosomes by controlling entry into multivesicular bodies
17136494 interaction between membrane-bound hyaluronan and the cell surface CD44 was involved in the up-regulation of FasL expression on T cells and subsequent activation-induced cell death
17123604 Significantly high Fas Ligand Protein is associated with aggressive NK-cell leukemia
17123522 expression of FasL is upregulated in testes of patients with Sertoli cell-only syndrome & maturation arrest, suggesting that it may be associated with apoptotic elimination or altered maturation of Fas-expressing germ cells by activation of caspase-3.
17118988 The data demonstrated that HIV-1 Tat enhances C. parvum-induced cholangiocyte apoptosis via a paracrine-mediated, FasL-dependent mechanism.
17118988 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
17101499 Pemphigus vulgaris patient IgG works together with Fas-L and tumor necrosis factor-alpha in experimental cell cultures to induce acantholysis via basal cell shrinkage.
17071607 These results suggest that apoptosis triggered by the release of soluble FasL from invading trophoblasts contributes to the loss of smooth muscle from the walls of spiral arteries during pregnancy.
17056762 We found that signaling through CD62L up-regulated FasL.
17053166 sFas concentrations are increased and sFasL are decreased in subjects at high cardiovascular risk, suggesting that these proteins may be novel markers of vascular injury.
17014925 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17014925 These results suggest that the FAS-1377G>A and -670A>G and FASL-844C>T polymorphisms do not significantly affect the susceptibility to lung cancer in Koreans.
17008914 Thus, our work unveils that Fas ligand-mediated apoptosis induces scrambling of mitochondrial and secretory organelles via a global alteration of membrane traffic that is modulated by apical caspases.
17000697 Observational study of gene-disease association. (HuGE Navigator)
16990614 Epithelial cell apoptosis and associated upregulation of Fas and apoptotic Fas pathway genes in epithelial cells of lungs with bleomycin-induced fibrosis.
16987075 Fas and FasL serum concentrations in patients coinfected with HIV and HCV indicate programmed cell death.
16972019 sFas, sFas-L, and MMP-3, which were significantly elevated in sera of active untreated AOSD patients and paralleled disease activity, may be involved in the pathogenesis of this disease
16902496 Thus, m-CD95L expressing APC might be used in clinical settings to obtain tolerance induction in allogeneic transplantation systems or autoimmune diseases.
16868256 most CD4(+)CD25(+)FOXP3(+) T cells found in cord blood are naive and exhibit low CD95 expression. Furthermore, most of these newborn T(regs) are not sensitive toward CD95L similar to naive T(regs) from adult individuals.
16858424 Our findings identify a novel proinflammatory role of FasL in keratinocytes that is independent of caspase activity and is separable from apoptosis.
16808908 Fas/FasL-mediated signaling pathways play crucial roles in apoptotic disturbances of T cell subsets, especially of CD4+ T cells from systemic lupus erythematosus patients with active disease.
16770006 The glucocorticoid receptor down-regulates fasL promoter by competing with NFkappaB for binding to the common response element.
16767155 findings show that deletion of primary thymocytes and Thy278 cells upon CD3 stimulation is considerably impaired by neutralizing CD95L antibody
16736614 There may exist significant correlation between the expression of Fas/FasL and the development of the infantile hemangioma cells.
16691186 Observational study of gene-disease association. (HuGE Navigator)
16691186 Study concludes that polymorphisms of FASL and FAS associate with type II diabetes and estimates of insulin resistance in Danish white subjects.
16601838 angiostatins K1-3, K1-4 and K1-4.5 mediate anti-angiogenesis in a process involvingp53, FasL, AKT and mRNA deregulation
16595663 chromatin remodeling is a primary event in the activation of TNFSF6 expression in primary and leukemia T cells
16595635 FasL-associated adaptor protein Nck is involved in the actin-dependent transport of FasL-bearing secretory lysosomes to the mimunological synapse.
16538172 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16538172 Genetic variants in the FAS and FASLG gene may contribute to the etiology of melanoma in the general population, particularly in those with a low risk of sunlight-induced melanoma.
16538171 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16538171 FAS and FASLG polymorphisms appear to jointly contribute to risk of bladder cancer in the southern Chinese population.
16514159 A marked up-regulation of TLR2 and Fas-FasL was detected in primary human gingival epithelial cells (HGEC) stimulated with heat-killed P. gingivalis
16512757 Observational study of gene-disease association. (HuGE Navigator)
16487513 Data obtained demonstrate that the combination of arsenite with inhibitors of COX-2 may affect the target cancer cells via induction of FasL-mediated death signaling.
16474169 Fas downregulation and a consequential increased resistance to FasL-triggered apoptosis resulting from upregulated MMP-7 in colorectal cancer cells could be a key mechanism for their escape from the immune surveillance
16441482 Observational study of gene-disease association. (HuGE Navigator)
16364925 thymosin beta-4 increases colon carcinoma apoptosis resistance triggered by FasL and apoptosis inhibitors by downregulating Fas and upregulating Survivin expression
16332972 Localization to lipid rafts appears to be predominantly mediated by the characteristic cytoplasmic proline-rich domain of Fas ligand.
16332967 a novel fusion protein, designated scFvCD7:sFasL is designed to have leukemia-restricted activity.
16318909 FCH/SH3 proteins might play an important role for the subcellular distribution and lysosomal association of FasL.
16313826 Observational study of gene-disease association. (HuGE Navigator)
16306044 Treatment of melanoma lines with soluble Fas ligand resulted in programmed cell death that was proportional to the pre-existing levels of surface Fas.
16298578 The FasLigand expression was up-regulated during acute kidney traft rejection episodes.
16282344 FasL is recruited into lipid rafts for maximum Fas receptor contact and cell death-inducing potency
16273638 Colon cancer cells can escape the immune surveillance and killing via decreasing Fas expression, and can counterattack the immune system via increasing FasL expression
16212902 These results indicate that aplastic anemia T cells are "preactivated", characterized by overexpression of FasL, especially intracellular FasL which can be stimulated to release in bioactive exosomes-bound form.
16204241 the intracellular Fas ligand (FasL) domain binding to the adaptor protein PSTPIP results in a cytoplasmic localization of FasL
16186185 Observational study of gene-disease association. (HuGE Navigator)
16181301 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16163374 Observational study of gene-disease association. (HuGE Navigator)
16158329 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16158329 The combination of some polymorphisms of Fas or FasL significantly influenced CD4+ T cell production and viral load decrease, showing that these genes can play a role in the immunoreconstitution triggered by antiretroviral therapy.
16157266 results suggest that hepatitis C virus and Fas ligand play a key role in hepatocarcinogenesis
16157125 Our data indicate an associaton between premature rupture of membranes and increased prevalence of neonatal AG genotype at -670 Fas promoter gene.
16155003 the trans-activation ability of Tat at the long terminal repeat does not correlate with T cell apoptosis but that the ability of Tat to up-regulate CD178 mRNA expression and induce apoptosis in T cells is critically dependent on the C terminus of Tat
16155003 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
16133992 During tuberculosis, predisposition of CD4 T-cell subsets to apoptosis may involve both low expression of Bcl-2 and excessive expression of Fas ligand (FasL).
16124644 The downwards expression of Fas and the upwards expression of FasL in nasal polyps may inhibit the cellular apoptosis and the enhanced hyperplasia.
16087126 Plasma levels may be a marker for chronic hepatitis C infections.
16081306 FASL expression on tumor-derived exosomes is required for induction of T-cell apoptosis, which appears to be a novel mechanism of tumor immune evasion.
16000573 Data strongly indicate that an increment of soluble FAS/soluble FASL ratio after treatment could be an excellent marker of chemosensitivity in colorectal cancer.
15996722 Observational study of gene-disease association. (HuGE Navigator)
15991293 The FasL expressed in human colon cancer cells may be regulated by endogenous factors in the microenvironment of the host and facilitate the escape of tumor cells from the host immune system.
15979995 sFasL and matrilysin are expressed in seminal plasma and have a role in regulation of the function of the Fas system
15975999 NF-kappaB may regulate Fas-mediated apoptosis in HIVAN by controlling the expression of Fas ligand in renal epithelium
15968727 Up-regulation of FasL expression plays an important role in invasive depth, histological classification and metastasis of gallbladder carcinoma.
15962391 The expression of FasL is upregulated in colon cancer and the functionally expressed FasL can induce apoptosis of Fas-expressing T lymphocytes.
15938782 Altered expression of Fas, FasL and PGF in trophoblasts of placenta influence the pathogenesis of pre-eclampsia.
15937082 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15937082 FASL polymorphisms contribute to susceptibility of lung cancer.
15936090 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
15928037 a linear pathway for Nef-induced FasL expression that encompasses p38 and AP-1 has been elucidated. Furthermore, chemical inhibition of the p38 pathway attenuates HIV-1-mediated bystander killing of CD8 cells in vitro
15928037 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
15907374 expression in oral and oropharyngeal squamous cell carcinomas is associated with tumor stage and grade
15870181 We evaluate a family with 4 of its 5 members harboring a mutation causing skipping of exon-6; ALPS in one male patient was caused by haploinsufficiency of membrane CD95 expression. Our data challenge the hypothesis that sCD95 causes autoimmunity
15870081 membrane-associated FasL is pro-apoptotic, whereas mFasL can be released from T lymphocytes.
15858021 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
15849828 Fas ligand is an apoptotic pathway of hepatocellular carcinoma cells.
15843521 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
15833141 The data suggest that lower expression of surface Fas, but higher levels of apoptosis-inhibiting sFas, contribute to the resistance of fibroblasts in lung fibrosis against apoptosis.
15816832 Cutaneous T cell lymphoma cells express functional FasL possibly contributing to bystander cytotoxicity within tumor infiltrates.
15814666 FasL-mediated cytotoxicity is regulated by the FasL cytoplasmic tail
15806311 Observational study of gene-disease association. (HuGE Navigator)
15803113 Serum levels may be affected by insulin resistance, but is not an effective markers of silent myocardial ischemia in type 2 diabetes.
15795317 The extracellular domains of FasL are sufficient to drive membrane FasL-induced formation of supramolecular Fas-FasL complexes, whereas soluble FasL-induced Fas aggregation is dependent on lipid rafts and the intracellular domain of Fas.
15791651 Effect of hibuscus polyphenol extracs in human gastric carcinoma cells is mediated via p53 signaling and p38 MAPK/FasL cascade pathway.
15694838 results suggest that p21 and FasL gene activation is required for myeloid leukemia cell survival or maturation but not for cell death via Sp1 and NFkappaB as regulators of these genes
15686714 Heart graft biopsies haveelevated FasL mRNA expression levels compared to the expression levels before and after acute rejection
15674374 Observational study of gene-disease association. (HuGE Navigator)
15653751 Supernatants from T cell blasts, pulse-stimulated with phytohemagglutinin contained FasL expressed on microvesicles .
15579659 FasL is produced by and stored in the first trimester human syncytiotrophoblasts only and they lack surface membranal FasL.
15557763 Fas and TRAIL play an important role in the H. pylori-mediated apoptosis of gastric epithelial cells.
15542843 activation of p38 MAPK and c-Jun N-terminal kinase pathways by hepatitis B virus X protein mediates apoptosis via induction of Fas/FasL and TNFR1/TNFa expression
15492869 A lymphoproliferative disorder could be associated with mutation in this ligand.
15480896 upregulation of mesangial FasL may contribute to the glomerular inflammation in proliferative lupus nephritis
15457562 sFasL may be involved in either induction of apoptosis or autoimmune diseases.
15358139 Data report that antagonism of the type 1 insulin-like growth factor receptor in combination with inhibitors of the epidermal growth factor receptor synergistically sensitizes human malignant glioma cells to CD95L-induced apoptosis.
15339846 CD95 and/or DR5 can induce apoptosis of CD40-activated chronic lymphocytic leukemia cells
15337758 FasL induces NF-kappaB activation and IL-8 production by a novel mechanism, distinct from that of TNF-alpha
15314293 FasL protein levels show that C57BL/10 cortical cultures are more resistant to death receptor-mediated apoptotic cell death as compared to C57BL/6 strain mice.
15302589 High levels of Max and stress-induced NFkappaB activation may result in elevated expression of Fas ligand in human lung cancer cells and possibly contribute to Fas ligand-associated immune escape mechanisms.
15287856 serum sFasL in biliary disease may be derived predominantly from activated immune cells and not from cancer cells
15277733 Cardiomyocyte necrosis and/or apoptosis via activated tumor necrosis factor (TNF) and the Fas/Fas ligand (FasL) system may be related to the development of ongoing myocardial damage.
15272306 CD95L, which is found elevated in many human cancer patients, has tumorigenic activities on human cancer cells
15240787 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
15218339 Observational study of gene-disease association. (HuGE Navigator)
15195700 addition of IL-12 might increase the efficacy of IL-2 immunotherapy by inhibition of the IL-10-mediated negative feed-back loop on IL-2-mediated sFasL release
15183989 The frequent expression and coexpression of Fas, FasL, and c-FLIP in urothelial carcinomas implicates c-FLIP as an inhibitor of the Fas-FasL-induced death pathway in these tumors.
15178561 The function of endothelial FasL during atherosclerosis was studied in APOE(-) mice transgenic for human FasL. Overexpression of endothelial FasL is antiinflammatory and inhibits atherosclerosis under hypercholesterolemic conditions.
15173177 fasL gene expression is induced by Hepatitis B virus X protein through enhancing transcriptional activity of Egr-2 and Egr-3
15138553 Significantly lower soluble form of fas is associated with bile duct carcinoma
15093732 FASL secretion was analyzed in melanoma cells in culture. The secretion was associated with secretory vesicles upon melanoma activation with phytohemagglutonins or alpha-MSH.
15078178 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
15073283 Results show that FasL in endometrial stromal cells in culture has a cyclic expression model, suggesting that there may be a regulation at the translation level.
15042330 Observational study of gene-disease association. (HuGE Navigator)
15042330 To evaluate the impact of genetic variations to apoptosis during progression of acquired immunodeficiency syndrome (AIDS), we have performed an extensive genetic analysis of Fas and Fas ligand ( FasL) genes.
15019279 The sensitivity of FasL expressing tumor cells to lysis by cytotoxic T-cells was similar to that of FasL non-expressors
14996347 examined the correlation between injury of the hepatocytes and mRNA expression of FasL and perforin/granzyme B in liver tissue to investigate the roles of both the FasL and the perforin/granzyme B pathways in chronic hepatitis B
14988839 CD95L derived from placenta acts systemically and is primary cause of liver damage in HELLP syndrome. Blocking CD95L can reduce liver cell apoptosis. Strategy may have therapeutic advantages.
14977837 Fas and FasL have roles in progression of breast cancer
14967838 Fas engagement with Fas ligand induced activation of Akt and upregulation of endothelial nitric oxide synthase expression without induction of apoptosis.
14962292 The observed impact of FasL on adhesion and transendothelial migration provides evidence for novel biological functions of FasL.
14739535 Observational study of gene-disease association. (HuGE Navigator)
14739407 NF-kappaB activation and FasL overexpression occur in PBMCs and atherosclerotic lesions of patients with carotid stenosis. The NF-kappaB-FasL pathway could be involved in the mechanisms underlying plaque instability in humans
14739003 This review considers the role of the FasL-Fas system as a double-edged sword in the central nervous system: maintaining the immune suppressed status in normal brain and inducing neuronal cell death and inflammation in a variety of neurologic disorders.
14705811 activated langerhan's cells are capable of expressing CD95-L in a functional location, thus bearing the potential to exert tolerogenic capabilities against CD95-expressing T cells
14698859 Observational study of gene-disease association. (HuGE Navigator)
14669310 expression levels in hepatocellular carcinoma, compard with HBxAg levels
14668794 expression of CD95 in 15/17 human melanoma cell lines analysed, but complete lack of CD95 ligand (CD95L)
14642527 FasL blocks expression of CD28 at the transcriptional level
14634098 As brief as a >10-min exposure of human T cells to fibronectin-associated recombinant FasL induces T cell activation and potentiates proinflammatory capacities, e.g., adhesion to extracellular matrix, IFN-gamma secretion, and retention in inflamed areas.
14625471 Fas and Fas ligand expression in leukocytes during systemic inflammation
14602201 hepatitis C virus core protein plays a role in the induction of functional FasL in a hepatoblastoma cell line
14560009 These results support a role for Egr-1, -2, and -3 in nonlymphoid expression of Fas ligand, TRAIL, and tumor necrosis factor.
14534535 Progesterone-induced apoptosis in immortalized normal and malignant HOSE cells involves enhanced expression of FASL.
14514471 Data show that Fas ligand is expressed on cytotoxic effector and memory cells, suggesting that the Fas/FasL system is involved in the inflammatory process observed in silicosis patients.
12930319 Fas ligand is not constitutively expressed in normal peripheral blood or neoplastic B lymphocytes
12928375 Modulation of FasL by placental as well as maternal hormonal milieu induces apoptosis in decidual cells, glandular cells, and immune cells, facilitating trophoblast invasion and peritrophoblastic immunotolerance.
12923319 induction of CD95/CD95L expression does not have a role in p53-induced apoptosis
12918731 Levels in CSF are elevated in in neuro-Behcet's disease.
12884192 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
12867600 Data suggest that increased intrathecal release of Fas, but not FasL or caspase 3, in the cerebrospinal fluid of infants with hydrocephalus may serve as an indicator of brain injury from progressive ventricular dilatation.
12854132 FasL is implicated in differentiation, growth, invasion and metastasis of gastric cancer by inducing apoptosis of infiltrating lymphocytes.
12849704 apoptosis by FasL-dependent ligation is not modulated by Bcl-2 in vivo
12807917 Fas ligand increases Kv1.3 channel activity through the same canonical apoptotic signaling cascade that is required for potassium efflux, cell shrinkage, and apoptosis
12803240 Fas/Fas-L and Bcl-2 expression participate in regulation of apoptosis in extravillous trophoblast(EVT) along invasion to decidua. Increased apoptosis in invasive phenotype of EVT may be attributable to increased Fas and Fas-L and decreased Bcl-2.
12794109 CTLA4-FasL fusion protein inhibits the primary mixed leukocyte reaction (MLR), induces specific hyporesponsiveness in the secondary MLR, and may potentially induce hyporesponsiveness by promoting both anergy and apoptosis of alloresponsive clones.
12787425 Lethal cytokines, such as FasL, may contribute to peritoneal cell turnover and the loss of mesothelium in peritoneal dialysis.
12783210 ATG-induced apoptosis in T cells involves both Fas and TNF pathways and TNF-alpha is produced much earlier than Fas and FasL expression.
12742739 Fas-FasL interactions may contribute to mechanisms of neuronal loss and neuritic degeneration in Alzheimer disease.
12742662 Longitudinal data indicate that FasL mRNA increases in peripheral blood mononuclear cells of multiple sclerosis (MS) patients, especially during the secondary progressive course, and is downregulated during clinical activity in relapsing remitting MS.
12717632 apoptosis mediated by Fas-FasL and engagement of CTLA-4 are involved in modulation of the immune response in patients infected with Paracoccidioides brasiliensis
12707034 Toxic epidermal necrolysis and Stevens-Johnson syndrome are induced by this protein.
12700199 cytokine-induced trophoblast apoptosis is mediated in part by the FasL/Fas pathway, suggesting that cytokines promote sensitivity to Fas-mediated apoptosis
12698366 results showed that Fas and/or Fas-Ligand, Bcl-2, and tissue transglutaminase may be involved in apoptotic pathways leading to mucosal atrophy in children with coeliac disease
12651606 expression and function in human urinary bladder transitional cell carcinomas; correlates with tumor progression
12637505 JNK/p38 > c-Jun > Fas ligand > Fas pathway plays an important role in mediating cisplatin-induced apoptosis in ovarian cancer cells
12629150 Cross-talk between glioma cells and neutrophils through the Fas/FasL system stimulated expression of IL-6 and IL-8 in glioma cells, enhanced neutrophil viability, and stimulated cytokine production in neutrophils.
12618758 An AP-1 site located in the 5' untranslated region of the CD95L gene is required for TCR/CD3-mediated induction of the human CD95L promoter.
12594300 Through the high and sustained expression of FasL that is transcriptionally regulated, synovial gamma delta T cells of the V delta 1 subtype may efficiently lyse a wide variety of cell types at sites of inflammation.
12583439 Bax, Bcl-2, fas and Fas-L antigen expression in human seminoma: correlation with the apoptotic index.
12559631 Observational study of gene-disease association. (HuGE Navigator)
12559631 To see if variants of the FasL gene played a role in Hashimoto's thyroiditis and Graves' disease, 2 FasL polymorphisms (C -843 T in the promoter, A IVS2nt-124 G in intron 2)were studied. No association was found.
12557947 Fas system as an inducer of apoptosis in cutaneous leishmaniasis
12515623 Fas-L expression may be associated with the escape from of immunal surveillance.
12513781 expression and function of fas ligand in human myeloid leukemia cells
12507389 The Fas ligand may be involved in the apoptosis of astrocytic tumors, and the apoptotic index can be a useful parameter for assessing prognosis of astrocytic tumors.
12490654 Somatostatin receptor subtype 2 sensitizes human pancreatic cancer cells to ligand-induced apoptosis
12482505 A role for the Fas/Fas ligand apoptotic pathway in regulating myeloid progenitor cell kinetics.
12482410 homeostatic regulation of myelopoiesis in bone marrow is mediated via an autoregulatory feedback loop via the Fas-FasL pathway
12464266 Cleavage of FasL by MMP-7 occurs at the leucine residues in sequence "ELAELR" within the region between the transmembrane and trimerization domains. When this site is unavailable, a "SL," is cleaved. MMP-7 differentially processes murine and human FasL
12454289 In transgenic mice, the human FASL promoter induces reporter expression in intestinal epithelial cells. Non-lymphoid FasL is expressed in response to peripheral T cell activation & regulates T cells that infiltrate peripheral tissues.
12421989 T cells from systemic lupus erythematosus patients kill autologous monocytes through apoptotic pathways involving the ligand FasL.
12414956 The human papillomavirus type 16 E5 protein impairs TRAIL- and FasL-mediated apoptosis in HaCaT cells by different mechanisms.
12414525 fas ligand is up-regulated in acute lung injury and the acute respiratory distress syndrome
12393889 tranduces, in synergy with non-cytotoxic anti-Fas monoclonal antibody (mAb), signals for apoptosis and nuclear translocation of the NF-kappaB (p65/p50) heterodimer
12372468 serum and peritoneal fluid of women with moderate to severe endometriosis contain elevated concentrations of soluble Fas ligand compared to women with minimal or mild endometriosis and women without endometriosis
12208869 inhibiton of CD95L expression by vitamin E
12161534 Regulation of fas ligand expression by IL-8 in human endometrium.
12137598 the role of Fas/Fas ligand (FasL) in tum orgenesis, immune escape, counterattack in colonic cancer
12113885 findings support the hypothesis that the expression of FasL in normal ovary is hormonally sensitive
12100038 Abnormal expression and function of Fas ligand of lachrymal glands and peripheral blood was found in Sjogren's syndrome patients with enlarged exocrine glands.
12021310 Induction of lymphocyte apoptosis by tumor cell secretion of FasL-bearing microvesicles.
12021072 "trophoblast-cytokine-Fas/FasL triad" determines the ability of the Fas/FasL system to regulate trophoblast viability
12009596 expressed during acute cellular rejection episodes after kidney transplantation
11994542 The endometrial cells expressed Fas and low levels of FasL
11965496 Observational study of gene-disease association. (HuGE Navigator)
11965496 Genetic polymorphisms of FasL (CD178) in human longevity
11961305 Differential expressions of Fas and Fas ligand in human placenta
11925103 FasL protein is an important mediator of apoptosis.
11909874 HIV Tat binds Egr proteins and enhances Egr-dependent transactivation of the Fas ligand promoter
11909874 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
11908702 physiological function of human sFasL is to delete the potentially auto-reactive "memory" lymphocytes
11895550 upregulation of Fas by IFN-gamma in SNU-638 may accelerate the apoptosis pathway through the Fas and FasL interaction between gastric cancer cells and immune cells
11882326 Fas/FasL pathway can be employed by monocytes/macrophages to induce VSMC apoptosis in the atherosclerotic lesions.
11856352 The results indicate that FasL inhibition by all-trans-RA involves a novel mechanism whereby the transcriptional function of NFAT is blocked.
11845233 evaluation of the FasL gene FASL on chromosome 1q23 as a candidate susceptibility gene for Type I diabetes
11830480 Up-regulation in highly malignant multiple myeloma plasma cells negatively regulates erythroblast maturation; a major pathogenetic mechanism of anemia in multiple myeloma.
11809905 expression was found mainly on astrocytes and microglial cells; no significant difference between cases with and without pontosubicular neuron necrosis
11801650 A minimal region of the fasL promoter has been identified containing the transcription start site and a noncanonical c-Myc-binding element, which mediates fasL promoter repression by the activated vitamin D3 receptor in T lymphocytes.
11788891 Expression of Fas and Fas ligand in esophageal tissue mucosa and carcinomas
11786482 Western blot analysis showed that butyrate increased Fas and Fas ligand levels in butyrate-induced apoptosis.
11751256 Induction of FasL expression by adhesion of endometrial stromal cells to the extracellular matrix may take part in the development of immunotolerance by inducing apoptosis of cytotoxic T lymphocytes
11739488 Differential secretion of Fas ligand microvesicles during activation-induced death of T cells
11716959 Expression of FasL gene in T cells of renal allograft recipients
11500835 Mouse cells expressing human membrane-bound, but not soluble, Fas ligand induce inflammation in vivo.
11438180 Observational study of gene-disease association. (HuGE Navigator)
11208609 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
11036836 Observational study of gene-disease association. (HuGE Navigator)
10799864 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
10671224 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
10224289 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
10072505 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
9971775 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
9920849 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
9801169 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
9672636 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
9475352 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
9247148 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
9226175 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
9002959 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells
7539892 HIV-1 Tat101 induces more protection against FasL-mediated apoptosis than HIV-1 Tat72 or negative control in FasL-treated CD4+ T cells

AA Sequence

MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPP      1 - 70
LKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEK     71 - 140
KELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHK    141 - 210
VYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYK    211 - 280
L//

Text Mined References (567)

PMID Year Title
27117663 2016 Apoptosis Markers in Breast Cancer Therapy.
26858129 2016 Site disparities in apoptotic variants as predictors of risk for second primary malignancy in patients with squamous cell carcinoma of the head and neck.
26826505 2016 Downregulation of let-7e-5p contributes to endothelial progenitor cell dysfunction in deep vein thrombosis via targeting FASLG.
26690594 Polymorphisms in FAS and CASP8 genes may contribute to the development of ALPS phenotype: a study in 25 patients with probable ALPS.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
26617948 2015 Significance of Fas and FasL protein expression in cardiac carcinoma and local lymph node tissues.
26617708 2015 Enhanced expression of Fas and FasL modulates apoptosis in the lungs of severe P. falciparum malaria patients with pulmonary edema.
26582200 2016 Lifeguard Inhibits Fas Ligand-mediated Endoplasmic Reticulum-Calcium Release Mandatory for Apoptosis in Type II Apoptotic Cells.
26479732 2016 Advanced glycation end-product (AGE) induces apoptosis in human retinal ARPE-19 cells via promoting mitochondrial dysfunction and activating the Fas-FasL signaling.
26467838 2015 Epstein-Barr virus-infected cells release Fas ligand in exosomal fractions and induce apoptosis in recipient cells via the extrinsic pathway.
26429326 2015 FAS -670 A/G polymorphism may be associated with the depletion of CD4(+) T lymphocytes in HIV-1 infection.
26400345 2015 FAS ligand expression in inflammatory infiltrate lymphoid cells as a prognostic marker in oral squamous cell carcinoma.
26374830 2015 Endothelial Fas-Ligand in Inflammatory Bowel Diseases and in Acute Appendicitis.
26359460 2015 Fas Ligand Deficiency Impairs Tumor Immunity by Promoting an Accumulation of Monocytic Myeloid-Derived Suppressor Cells.
26345794 2015 Study on the correlation between the expression of Ki67 and FasL and prognosis of cervical carcinoma.
26334989 2015 Decreased activation-induced cell death by EBV-transformed B-cells from a patient with autoimmune lymphoproliferative syndrome caused by a novel FASLG mutation.
26232171 2015 Platelets induce apoptosis via membrane-bound FasL.
26102031 2015 Decoy receptor 3 suppresses FasL-induced apoptosis via ERK1/2 activation in pancreatic cancer cells.
25990938 2015 The relationship between hepatitis B virus (HBV) load and levels of transforming growth factor beta 1 (TGF-?1) and soluble Fas (sFas) in human immunodeficiency virus patients with occult HBV infection.
25976983 2015 Apoptotic variants as predictors of risk of oropharyngeal cancer recurrence after definitive radiotherapy.
25950471 2015 FAS-ligand regulates differential activation-induced cell death of human T-helper 1 and 17 cells in healthy donors and multiple sclerosis patients.
25944167 2015 Susceptibility to oral cancers with CD95 and CD95L promoter SNPs may vary with the site and gender.
25745808 2015 Subcellular localization and activation of ADAM proteases in the context of FasL shedding in T lymphocytes.
25596086 2015 FasL -844T/C and Fas -1377G/A: mutations of pulmonary adenocarcinoma in South China and their clinical significances.
25529148 2015 TNF-? confers resistance to Fas-mediated apoptosis in rheumatoid arthritis through the induction of soluble Fas.
25510486 2015 Thymineless death in F10-treated AML cells occurs via lipid raft depletion and Fas/FasL co-localization in the plasma membrane with activation of the extrinsic apoptotic pathway.
25464339 2014 Protective efficacy of vitamins C and E on p,p'-DDT-induced cytotoxicity via the ROS-mediated mitochondrial pathway and NF-?B/FasL pathway.
25437350 2015 Upregulation of the sFas/sFasL system in psoriatic patients.
25416956 2014 A proteome-scale map of the human interactome network.
25404054 2015 Inhibitory CD200R and proapoptotic CD95/CD95L molecules on innate immunity cells are modulated by cardiac surgery.
25394756 2015 MiR-21 up-regulation mediates glioblastoma cancer stem cells apoptosis and proliferation by targeting FASLG.
25378591 2014 Intestinal expression of Fas and Fas ligand is upregulated by bacterial signaling through TLR4 and TLR5, with activation of Fas modulating intestinal TLR-mediated inflammation.
25366259 2014 CD95 and CD95L promote and protect cancer stem cells.
25333257 2014 Fas signaling promotes chemoresistance in gastrointestinal cancer by up-regulating P-glycoprotein.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25225287 2014 Pigment epithelial-derived factor (PEDF)-triggered lung cancer cell apoptosis relies on p53 protein-driven Fas ligand (Fas-L) up-regulation and Fas protein cell surface translocation.
25169582 2014 Polymorphisms of the apoptosis-related FAS and FAS ligand genes in keratoconus and Fuchs endothelial corneal dystrophy.
25078097 2014 Distinct effects of soluble and membrane-bound fas ligand on fibroblast-like synoviocytes from rheumatoid arthritis patients.
25059065 2014 [Soluble apoptosis markers in obese patients with food intolerance].
25056888 2014 Plasmacytoid dendritic cells mediate synergistic effects of HIV and lipopolysaccharide on CD27+ IgD- memory B cell apoptosis.
24999842 2014 Genome-wide association study of celiac disease in North America confirms FRMD4B as new celiac locus.
24924176 2014 Participation of the Fas/FasL signaling pathway and the lung microenvironment in the development of osteosarcoma lung metastases.
24899502 2014 Coordinated histone H3 methylation and acetylation regulate physiologic and pathologic fas ligand gene expression in human CD4+ T cells.
24821435 2014 miR-21 regulates N-methyl-N-nitro-N'-nitrosoguanidine-induced gastric tumorigenesis by targeting FASLG and BTG2.
24815844 Functional genetic variants in apoptosis-associated FAS and FASL genes and risk of bladder cancer in a Turkish population.
24802849 2014 Fas/Fas ligand mediates keratinocyte death in sunitinib-induced hand-foot skin reaction.
24729186 2014 Circulating levels of soluble Fas ligand reflect disease progression in multiple myeloma.
24690069 2014 Association of functional polymorphisms in FAS and FAS Ligand genes promoter with pre-eclampsia.
24665877 2014 Possible association of FAS and FASLG polymorphisms with the risk of idiopathic azoospermia in southeast Turkey.
24634493 2014 Functional NK cell repertoires are maintained through IL-2R? and Fas ligand.
24619598 2014 Association between CD95L polymorphism and cervical cancer risk: evidence from a meta-analysis.
24598538 2014 Association of the polymorphisms in the Fas/FasL promoter regions with cancer susceptibility: a systematic review and meta-analysis of 52 studies.
24561085 2014 Fas, FasL, and cleaved caspases 8 and 3 in glioblastomas: a tissue microarray-based study.
24534457 2014 Soluble Fas ligand is associated with natural killer cell dynamics in coronary artery disease.
24518159 2014 Survival of porcine fibroblasts enhanced by human FasL and dexamethasone-treated human dendritic cells in vitro.
24473454 2014 FasL gene -844T/C mutation of esophageal cancer in South China and its clinical significance.
24424626 2014 Association of genetic variants in apoptosis genes FAS and FASL with radiation-induced late toxicity after prostate cancer radiotherapy.
24408012 2014 FASLG T844C polymorphism and susceptibility to breast cancer: a meta-analysis.
24375196 2014 Associations between Fas/FasL polymorphisms and susceptibility to cervical cancer: a meta-analysis.
24347794 2013 FAS and FASL gene polymorphisms are not associated with hepatitis B virus infection based on a case-control study in a Brazilian population.
24335017 2013 Impact of MiR-21 on the expression of FasL in the presence of TGF-?1.
24291222 2014 Differential protein-protein interactions of full length human FasL and FasL fragments generated by proteolysis.
24289581 2013 Glaucocalyxin A activates FasL and induces apoptosis through activation of the JNK pathway in human breast cancer cells.
24265545 2013 Measurement of tumor necrosis factor-alpha, interleukin-6, Fas ligand, interleukin-1?, and interleukin-1? in the aqueous humor of patients with open angle glaucoma using multiplex bead analysis.
24248546 2014 Quantitative assessment of the association between three polymorphisms in FAS and FASL gene and breast cancer risk.
24228099 2013 FasL on human nucleus pulposus cells prevents angiogenesis in the disc by inducing Fas-mediated apoptosis of vascular endothelial cells.
24184557 2013 Exosomes secreted by human placenta carry functional Fas ligand and TRAIL molecules and convey apoptosis in activated immune cells, suggesting exosome-mediated immune privilege of the fetus.
24178789 2014 Fas and FasL expression in human adipose tissue is related to obesity, insulin resistance, and type 2 diabetes.
24094130 2014 Association between FAS and FASL genetic variants and risk of primary brain tumor.
24086353 2013 FASL rs763110 polymorphism contributes to cancer risk: an updated meta-analysis involving 43,295 subjects.
24072745 2013 CD95L cell surface cleavage triggers a prometastatic signaling pathway in triple-negative breast cancer.
23991192 2013 Enhancing production and cytotoxic activity of polymeric soluble FasL-based chimeric proteins by concomitant expression of soluble FasL.
23923075 2013 Expression of soluble Fas and soluble FasL in human nucleus pulposus cells.
23850805 2013 Sequential decisions on FAS sequencing guided by biomarkers in patients with lymphoproliferation and autoimmune cytopenia.
23846297 2013 Silencing of decoy receptor 3 (DcR3) expression by siRNA in pancreatic carcinoma cells induces Fas ligand-mediated apoptosis in vitro and in vivo.
23790081 2013 Increased preoperative serum apoptosis marker fas ligand correlates with histopathology and new-onset of atrial fibrillation in patients after cardiac surgery.
23697029 2013 Expression of Fas protein (CD95) and Fas ligand in liver tissue of patients with HCV-induced chronic liver disease and its correlation with the disease progression.
23682624 2013 Serum soluble fas ligand levels in familial Mediterranean fever.
23681795 2013 Associations of three common polymorphisms in CD95 and CD95L promoter regions with gastric cancer risk.
23618817 2013 Functional polymorphisms in FAS and FASL contribute to risk of squamous cell carcinoma of the larynx and hypopharynx in a Chinese population.
23582102 2013 Soluble Fas and Fas-ligand levels in mid-trimester amniotic fluid and their associations with severe small for gestational age fetuses: a prospective observational study.
23560484 2013 Evaluation of death pathway genes FAS and FASL polymorphisms in chronic HBV infection.
23534738 2013 Effects of FasL expression in oral squamous cell cancer.
23504349 2013 MiR-21 down-regulation suppresses cell growth, invasion and induces cell apoptosis by targeting FASL, TIMP3, and RECK genes in esophageal carcinoma.
23420824 2013 FAS and FAS-L genotype and expression in patients with recurrent pregnancy loss.
23405244 2013 Knowledge-based identification of soluble biomarkers: hepatic fibrosis in NAFLD as an example.
23392773 2013 Apoptosis-related Fas and FasL gene polymorphisms' associations with knee osteoarthritis.
23330016 2013 Distinct different sensitivity of Treg and Th17 cells to Fas-mediated apoptosis signaling in patients with acute coronary syndrome.
23285481 2012 Fas/FasL promoter gene polymorphism in patients with rheumatoid arthritis.
23280017 2012 Altered expression of survivin, Fas and FasL contributed to cervical cancer development and metastasis.
23269121 2013 The CD95/CD95L pathway is involved in phagocytosis-induced cell death of monocytes and may account for sustained inflammation in neonates.
23234803 2013 Genetic polymorphisms in the Fas and FasL genes are associated with epithelial ovarian cancer risk and clinical outcomes.
23192951 2013 Fas ligand plays an important role for the production of pro-inflammatory cytokines in intervertebral disc nucleus pulposus cells.
23184030 2013 Increase in soluble CD95L during subacute phases after human spinal cord injury: a potential therapeutic target.
23177026 2013 The serum miR-21 level serves as a predictor for the chemosensitivity of advanced pancreatic cancer, and miR-21 expression confers chemoresistance by targeting FasL.
23153021 2013 Genetic polymorphisms in FAS (CD95) and FAS ligand (CD178) promoters and risk of tobacco-related oral carcinoma: gene-gene interactions in high-risk Indians.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23076876 2013 Corticotropin-releasing hormone (CRH) is expressed in the human cervical carcinoma cells (HeLa) and upregulates the expression of Fas ligand.
23065018 2013 Immunohistochemical expression of Fas ligand (FasL) and neprilysin (neutral endopeptidase/CD10) in keratoconus.
23045958 2013 Expression of Fas and Fas ligand in primary cutaneous squamous cell carcinoma in association with grade of tumor differentiation.
22946667 2012 Fas, Fas Ligand, and vitamin D Receptor FokI gene polymorphisms in patients with type 1 diabetes mellitus in the Aegean region of Turkey.
22942752 2012 Decidual macrophages are significantly increased in spontaneous miscarriages and over-express FasL: a potential role for macrophages in trophoblast apoptosis.
22942738 2012 The tricyclodecan-9-yl-xanthogenate D609 triggers ceramide increase and enhances FasL-induced caspase-dependent and -independent cell death in T lymphocytes.
22927007 2013 ER? signaling regulates MMP3 expression to induce FasL cleavage and osteoclast apoptosis.
22891283 2012 Vesicles released by activated T cells induce both Fas-mediated RIP-dependent apoptotic and Fas-independent nonapoptotic cell deaths.
22860894 2012 Genetic polymorphisms of tumour necrosis factor receptor superfamily 1b and fas ligand are associated with clinical efficacy and/or acute severe infusion reactions to infliximab in Crohn's disease.
22842170 Myoepithelial expression of Fas and strong nuclear expression of FasL in epithelial cells: a marker for risk stratification of breast cancer.
22821704 2013 Multi-loci analysis reveals the importance of genetic variations in sensitivity of platinum-based chemotherapy in non-small-cell lung cancer.
22763913 2012 Aberrant expression of corticotropin-releasing hormone in pre-eclampsia induces expression of FasL in maternal macrophages and extravillous trophoblast apoptosis.
22732091 2012 FASL-844 T/C polymorphism: a biomarker of good prognosis of breast cancer in the Tunisian population.
22726303 2012 Plasma concentrations of soluble Fas receptors (Fas) and Fas ligands (FasL) in relation to CD4+ cell counts in HIV-1 positive and negative patients in Yaounde, Cameroon.
22706245 2012 Schizophrenia is associated with increased levels of serum Fas and FasL.
22702044 2012 [Effect of different concentrations of dexamethasone on apoptosis and expression of Fas/FasL in human osteoarthritis chondrocytes].
22645131 2012 Signaling active CD95 receptor molecules trigger co-translocation of inactive CD95 molecules into lipid rafts.
22631677 2012 Association between the FAS/FASL polymorphisms and gastric cancer risk: a meta-analysis.
22609371 2012 Seawater induces apoptosis in alveolar epithelial cells via the Fas/FasL-mediated pathway.
22535954 2012 Fas ligand enhances malignant behavior of tumor cells through interaction with Met, hepatocyte growth factor receptor, in lipid rafts.
22499988 2012 Fas ligand-Fas signaling participates in light-induced apoptotic death in photoreceptor cells.
22461695 2012 Decitabine and vorinostat cooperate to sensitize colon carcinoma cells to Fas ligand-induced apoptosis in vitro and tumor suppression in vivo.
22449797 2012 NK cells from HCV-infected patients effectively induce apoptosis of activated primary human hepatic stellate cells in a TRAIL-, FasL- and NKG2D-dependent manner.
22344564 2012 Expression levels of Fas/Fas-L mRNA in human brain glioma stem cells.
22341864 2012 Underlying mechanisms of cAMP- and glucocorticoid-mediated inhibition of FasL expression in activation-induced cell death.
22331638 2012 Severe necroinflammatory reaction caused by natural killer cell-mediated Fas/Fas ligand interaction and dendritic cells in human hepatocyte chimeric mouse.
22330070 2012 AMP-activated protein kinase mediates T cell activation-induced expression of FasL and COX-2 via protein kinase C theta-dependent pathway in human Jurkat T leukemia cells.
22211869 2012 Functional polymorphisms in FAS, FASL and CASP8 genes and risk of childhood acute lymphoblastic leukemia: a case-control study.
22207003 2012 Apoptosis markers soluble Fas (sFas), Fas Ligand (FasL) and sFas/FasL ratio in patients with bacteremia: a prospective cohort study.
22199323 2011 Circulating CD95-ligand as a potential prognostic marker for recurrence in patients with synchronous colorectal liver metastases.
22182632 2012 Evolution of soluble forms of CD86, CD95 and CD95L molecules in liver transplant recipients.
22172872 2011 High expression of Fas ligand on cord blood dendritic cells: a possible immunoregulatory mechanism after cord blood transplantation.
22161157 2012 Weapons ovarian epithelial tumors may use in immune escape: an immunohistochemical correlational study.
22153754 2013 The significant immunological characteristics of peripheral blood neutrophil-to-lymphocyte ratio and Fas ligand expression incidence in nephrectomized tumor in late recurrence from renal cell carcinoma.
22099756 2011 Modest effects of Fas-ligand and heme oxygenase-1 double transgenic mouse islets on transplantation outcomes.
22027769 2011 [Apoptosis and expression of Fas/FasL in tumor infiltrating dendritic cells in human endometrioid adenocarcinoma].
21955608 2013 Prostaglandin I2 induces apoptosis via upregulation of Fas ligand in pulmonary artery smooth muscle cells from patients with idiopathic pulmonary arterial hypertension.
21940365 Functional polymorphisms in FAS/FASL system contribute to the risk of occurrence but not progression of gastric cardiac adenocarcinoma.
21910009 2011 Fas/FasL pathway-mediated alveolar macrophage apoptosis involved in human silicosis.
21879377 2012 Evaluation of apoptosis-related gene Fas (CD95) and FasL (CD178) polymorphisms in Iranian rheumatoid arthritis patients.
21864851 2012 Evaluation of apoptosis-related genes: Fas (CD94), FasL (CD178) and TRAIL polymorphisms in Iranian multiple sclerosis patients.
21864388 2011 Lack of association between gene polymorphisms of Angiotensin converting enzyme, Nod-like receptor 1, Toll-like receptor 4, FAS/FASL and the presence of Helicobacter pylori-induced premalignant gastric lesions and gastric cancer in Caucasians.
21808135 2011 Fas receptor (CD95) & Fas ligand (CD178) expression in patients with tobacco-related intraoral squamous cell carcinoma.
21807637 2011 A polymorphic -844T/C in FasL promoter predicts survival and relapse in non-small cell lung cancer.
21806408 2011 Association of FAS and FAS ligand polymorphisms with the susceptibility and severity of lumbar disc degeneration in Chinese Han population.
21803845 2011 PMLRAR? binds to Fas and suppresses Fas-mediated apoptosis through recruiting c-FLIP in vivo.
21746966 2011 Foxp3-mediated suppression of CD95L expression confers resistance to activation-induced cell death in regulatory T cells.
21729539 2011 [Mechanism of Fas/FasL signal transduction pathway in K562 cell apoptosis induced by diallyl disulfide].
21725926 Increased apoptosis and expression of FasL, Bax and caspase-3 in human lupus nephritis class II and IV.
21695404 2013 Correlation of insulin resistance, beta cell function and insulin sensitivity with serum sFas and sFasL in newly diagnosed type 2 diabetes.
21691772 2011 Escherichia coli induces apoptosis in human monocytic U937 cells through the Fas/FasL signaling pathway.
21625644 2011 Modulation of the CD95-induced apoptosis: the role of CD95 N-glycosylation.
21605112 2011 A critical role for FcgammaRIIB in up-regulation of Fas ligand induced by a microbial polysaccharide.
21528407 2012 Soluble Fas and Fas ligand and prognosis in children with acute lymphoblastic leukemia.
21516345 2011 Matrix metalloproteinases and soluble Fas/FasL system as novel regulators of apoptosis in children and young adults on chronic dialysis.
21466843 2011 Celastrol induces apoptosis in non-small-cell lung cancer A549 cells through activation of mitochondria- and Fas/FasL-mediated pathways.
21368861 2010 Palmitoylation of human FasL modulates its cell death-inducing function.
21354149 2011 S-nitrosylation of the death receptor fas promotes fas ligand-mediated apoptosis in cancer cells.
21286777 2011 Genetic polymorphisms of TP53 and FAS promoter modulate the progression of coronary artery disease after coronary artery bypass grafting: a gender-specific view.
21285513 2011 The biological activity of FasL in human and mouse lungs is determined by the structure of its stalk region.
21271302 2012 Tissue expression of the proteins fas and fas ligand in colorectal cancer and liver metastases.
21270445 2011 Deficiency of SATB1 expression in Sezary cells causes apoptosis resistance by regulating FasL/CD95L transcription.
21227011 2010 Differential levels of cytokines and soluble Fas ligand between tuberculous and malignant effusions.
21159039 2011 Proapoptotic effect of metalloproteinase 9 secreted by trophoblasts on endothelial cells.
21152963 2012 Stimulation of FasL induces production of proinflammatory mediators through activation of mitogen-activated protein kinases and nuclear factor-?B in THP-1 cells.
21122378 2010 [Killing effect of interleukin-18-enhanced FasL-expressing colon cancer cells on human hepatocytes in vitro].
21107701 2011 The ribonucleotide reductase R1 subunits of herpes simplex virus types 1 and 2 protect cells against TNF?- and FasL-induced apoptosis by interacting with caspase-8.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21087335 2011 Fas-FasL system in molar pregnancy.
20959405 2010 The IFNG (IFN-gamma) genotype predicts cytogenetic and molecular response to imatinib therapy in chronic myeloid leukemia.
20842669 2010 Polymorphisms of death pathway genes FAS and FASL and risk of nasopharyngeal carcinoma.
20726934 2011 Fas-ligand staining in non-drug- and drug-induced maculopapular rashes.
20675370 2010 FasL expression in activated T lymphocytes involves HuR-mediated stabilization.
20673483 2010 [Immune evasion of human lung carcinoma cell A549 suppressed by human lymphoma cell Jurkat via Fas/FasL pathway].
20650551 2010 Fat intake interacts with polymorphisms of Caspase9, FasLigand and PPARgamma apoptotic genes in modulating Crohn's disease activity.
20624652 2010 IL-13 and TH2 cytokine exposure triggers matrix metalloproteinase 7-mediated Fas ligand cleavage from bronchial epithelial cells.
20618494 2010 FAS, FAS ligand, tumor infiltrating lymphocytes, and macrophages in malignant melanoma: an immunohistochemical study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20572163 2010 Functional polymorphisms in cell death pathway genes and risk of renal cell carcinoma.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20533543 2010 Extracellular calreticulin is present in the joints of patients with rheumatoid arthritis and inhibits FasL (CD95L)-mediated apoptosis of T cells.
20501759 2010 FAS and FASLG genetic variants and risk for second primary malignancy in patients with squamous cell carcinoma of the head and neck.
20438363 2010 Fas and FasL polymorphisms are not associated with acute myeloid leukemia risk in Koreans.
20408337 2010 Underexpression and overexpression of Fas and Fas ligand: a double-edged sword.
20406899 2010 FasL gene knock-down therapy enhances the antiglioma immune response.
20394629 2010 Functional polymorphisms of the FAS/FASLG genes are associated with risk of alopecia areata in a Chinese population: a case-control analysis.
20393600 2010 Acrolein induces apoptosis through the death receptor pathway in A549 lung cells: role of p53.
20385987 2010 Interactions among genetic variants in apoptosis pathway genes, reflux symptoms, body mass index, and smoking indicate two distinct etiologic patterns of esophageal adenocarcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20379197 2010 Mutant PIK3CA licenses TRAIL and CD95L to induce non-apoptotic caspase-8-mediated ROCK activation.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
20371612 2010 Foxo3a regulates apoptosis by negatively targeting miR-21.
20359312 2010 Polymorphisms in the apoptosis-associated genes FAS and FASL and risk of oral cancer and malignant potential of oral premalignant lesions in a Taiwanese population.
20353032 2010 [Effect of combined application of psoralen and ultraviolet A for inducing NB4 cell apoptosis and its impact on Fas/FasL gene expressions].
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20222173 2010 Clinical significance of Fas and FasL protein expression in gastric carcinoma and local lymph node tissues.
20219325 2010 Polymorphisms of FAS and FAS ligand genes and risk of skin cancer.
20204402 2010 Analysis of common germline polymorphisms as prognostic factors in patients with lymph node-positive breast cancer.
20193111 2010 Correlation of Fas/FasL expression to cell apoptosis in Epstein-Barr virus-associated gastric carcinoma.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20165911 2010 Expression of the Fas-ligand gene in ejaculated sperm from adolescents with and without varicocele.
20150914 2010 Fas ligand gene expression is directly regulated by stress-inducible heat shock transcription factor-1.
20106900 2010 International Lung Cancer Consortium: coordinated association study of 10 potential lung cancer susceptibility variants.
20101459 2010 The role of MAPK-ERK pathway in 67-kDa laminin receptor-induced FasL expression in human cholangiocarcinoma cells.
20074157 2010 Polymorphisms in promoter region of FAS and FASL gene and risk of cardia gastric adenocarcinoma.
20013612 2010 Fas ligand (FasL, Apo-1L/CD95L) expression and clinical outcome in papillary microcarcinoma and papillary thyroid carcinomas with diameter smaller than 1.5 centimeters.
19960225 2010 Connexin32 hemichannels contribute to the apoptotic-to-necrotic transition during Fas-mediated hepatocyte cell death.
19941645 2009 Fas and FasL gene polymorphisms are not associated with cervical cancer but differ among Black and Mixed-ancestry South Africans.
19937732 2010 Taiwan cobra phospholipase A2-elicited JNK activation is responsible for autocrine fas-mediated cell death and modulating Bcl-2 and Bax protein expression in human leukemia K562 cells.
19926197 2010 Polymorphisms of FAS and FAS ligand genes in preeclamptic women.
19890662 2010 TNF superfamily gene polymorphism as prognostic factor in early breast cancer.
19854829 2009 X chromosome-linked inhibitor of apoptosis regulates cell death induction by proapoptotic receptor agonists.
19826071 2010 Fas/Fas ligand-mediated apoptosis in different cell lineages and functional compartments of human lymph nodes.
19810143 Expression of Fas/FasL in patients with oral lichen planus.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19779494 2010 Caspase-mediated inhibition of sphingomyelin synthesis is involved in FasL-triggered cell death.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19641134 2009 Membrane-bound Fas ligand requires RIP1 for efficient activation of caspase-8 within the death-inducing signaling complex.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19614955 2009 The -509C/T polymorphism of transforming growth factor-beta1 is associated with increased risk for development of chronic idiopathic neutropenia.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19572057 2009 Helicobacter pylori increases expression of proapoptotic markers Fas and FasL on CD4 lymphocytes in children.
19565204 2009 FAS and FAS ligand polymorphisms in the promoter regions and risk of gastric cancer in Southern China.
19542541 2009 Polymorphisms in cell death pathway genes are associated with altered sperm apoptosis and poor semen quality.
19538867 2009 [Association between Fas/Fas L genes promoter polymorphisms and pathogenic risk of cervical cancer].
19535642 2009 Selective reduction of graft-versus-host disease-mediating human T cells by ex vivo treatment with soluble Fas ligand.
19531476 2009 Cytotoxicity mediated by the Fas ligand (FasL)-activated apoptotic pathway in stem cells.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19505222 2009 Tumour necrosis factor-alpha and soluble Fas ligand as biomarkers in non-acetaminophen-induced acute liver failure.
19458913 2009 The distribution and intracellular location of Fas and Fas Ligand following gastric carcinogenesis: Fas Ligand expressing gastric carcinoma cells can inhibit local immune response.
19434529 2009 [Effect of FasL gene expression on proliferation and apoptosis of rectal carcinoma cells in hypoxia state].
19403301 2009 FASLG polymorphism is associated with cancer risk.
19390575 2009 Lung cancer susceptibility model based on age, family history and genetic variants.
19364818 2009 Fas-mediated apoptosis is regulated by the extracellular matrix protein CCN1 (CYR61) in vitro and in vivo.
19337311 2009 The FAS ligand promoter polymorphism, rs763110 (-844C>T), contributes to cancer susceptibility: evidence from 19 case-control studies.
19332441 2009 FasL cross-linking inhibits activation of human peripheral T cells.
19305072 Expressions of Fas/DcR3 and RGD-FasL mediated apoptosis in pituitary adenomas.
19266094 2009 The role of MMP7 and its cross-talk with the FAS/FASL system during the acquisition of chemoresistance to oxaliplatin.
19244619 2009 A non-apoptotic role for Fas/FasL in erythropoiesis.
19240174 2009 Polymorphisms in the FAS and FASL genes and survival of early stage non-small cell lung cancer.
19219602 2009 Prostaglandin synthase 2/cyclooxygenase 2 (PTGS2/COX2) 8473T>C polymorphism associated with prognosis for patients with colorectal cancer treated with capecitabine and oxaliplatin.
19183163 2009 Infliximab dependency in children with Crohn's disease.
19181929 2009 Serum DNase I, soluble Fas/FasL levels and cell surface Fas expression in patients with SLE: a possible explanation for the lack of efficacy of hrDNase I treatment.
19176318 2009 FAS-L, IL-10, and double-negative CD4- CD8- TCR alpha/beta+ T cells are reliable markers of autoimmune lymphoproliferative syndrome (ALPS) associated with FAS loss of function.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19155494 2009 Human circulating CD4+CD25highFoxp3+ regulatory T cells kill autologous CD8+ but not CD4+ responder cells by Fas-mediated apoptosis.
19146781 2009 FAS and FASLG polymorphisms and susceptibility to idiopathic azoospermia or severe oligozoospermia.
19141860 2009 Genetic variants in the candidate genes of the apoptosis pathway and susceptibility to chronic myeloid leukemia.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19079288 2009 Distinct requirements for activation-induced cell surface expression of preformed Fas/CD95 ligand and cytolytic granule markers in T cells.
19052714 2009 TP53 codon 72 polymorphism associated with prognosis in patients with advanced gastric cancer treated with paclitaxel and cisplatin.
19041431 2009 Identification of interaction partners for individual SH3 domains of Fas ligand associated members of the PCH protein family in T lymphocytes.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
19015953 2009 Serum sFas and tumor tissue FasL negatively correlated with survival in Egyptian patients suffering from breast ductal carcinoma.
19010354 2009 A possible role of Fas-ligand-mediated "reverse signaling" in pathogenesis of rheumatoid arthritis and systemic lupus erythematosus.
19009351 2009 SBDS-deficiency results in specific hypersensitivity to Fas stimulation and accumulation of Fas at the plasma membrane.
18854777 2008 Germline genetic variations in drug action pathways predict clinical outcomes in advanced lung cancer treated with platinum-based chemotherapy.
18844072 2008 [Fas-FasL and caspase-3 signal transduction pathway and apoptosis of peripheral T lymphocytes in ITP patients].
18835034 2008 Plasminogen activator inhibitor-1 protects endothelial cells from FasL-mediated apoptosis.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18813857 2008 Evaluation of apoptotic cells and immunohistochemical detection of FAS, FAS-L, Bcl-2, Bax, p53 and c-Myc in the skin of patients with chronic venous leg ulcers.
18800686 2008 [Apoptosis of active T lymphocytes induced by human laryngocarcinoma cell line].
18789888 2008 The adaptor protein Grb2 regulates cell surface Fas ligand in Schwann cells.
18757527 2008 Apoptosis gene polymorphisms, age, smoking and the risk of non-small cell lung cancer.
18727868 2008 [Regulation role of superoxide dismutase coenzyme on Fas/FasL signal transduction and apoptosis in alveolar macrophages of pneumoconiosis patients].
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18666137 2008 Genetic polymorphisms of IL-1A, IL-1B, IL-1RN, NFKB1, FAS, and FASL, and risk of silicosis in a Chinese occupational population.
18577653 2008 Association of Fas Ligand gene polymorphism with Stevens-Johnson syndrome.
18567840 2008 Neutrophil-dependent tumor rejection and priming of tumoricidal CD8+ T cell response induced by dendritic cells overexpressing CD95L.
18561948 2008 Elevated Fas expression is related to increased apoptosis of circulating CD8+ T cell in patients with gastric cancer.
18548110 2008 Functional polymorphisms of the FAS gene associated with risk of vitiligo in Chinese populations: a case-control analysis.
18541195 2008 Evaluation of angiopoietins and cell-derived microparticles after stem cell transplantation.
18509086 2008 Up-regulation of c-FLIP short by NFAT contributes to apoptosis resistance of short-term activated T cells.
18505906 2008 Differential expression of Fas system apoptotic molecules in peripheral lymphocytes from patients with Graves' disease and Hashimoto's thyroiditis.
18501631 2008 Improved secretion of human Fas ligand extracellular domain by N-terminal part truncation in Pichia pastoris and preparation of the N-linked carbohydrate chain trimmed derivative.
18483392 2008 Functional variants in cell death pathway genes and risk of pancreatic cancer.
18473402 2008 Relationship between expression of gastrin, somatostatin, Fas/FasL and caspases in large intestinal carcinoma.
18427836 2008 Fas/FasL-dependent apoptosis of hepatocytes induced in rat and patients with Clonorchis sinensis infection.
18422813 2008 Placental fas/fas ligand expression in early pregnancy losses.
18392917 2008 Fas ligand expression on human nucleus pulposus cells decreases with disc degeneration processes.
18383830 Polymorphisms of death pathway genes FAS and FASL and risk of premalignant gastric lesions.
18374107 2008 Adenoviral-mediated overexpression of either membrane-bound human FasL or human decoy Fas can prolong pig islet xenograft survival in a rat transplant model.
18361934 2008 Evaluation of functional single nucleotide polymorphisms of different genes coding for the immunoregulatory molecules in patients with monoclonal large granular lymphocyte lymphocytosis.
18359029 2008 Soluble Fas ligand plasma levels are associated with forearm reactive hyperemia in subjects with coronary artery disease: a novel biomarker of endothelial function?
18324486 2008 Identification of apoptotic proteins in thyroid gland from patients with Graves' disease and Hashimoto's thyroiditis.
18316328 2008 Coelomic cells show apoptosis via Fas/FasL system: a comparative study between healthy human pregnancies and missed miscarriages.
18314443 2008 Resistance to FasL and tumor necrosis factor-related apoptosis-inducing ligand-mediated apoptosis in Sezary syndrome T-cells associated with impaired death receptor and FLICE-inhibitory protein expression.
18302883 2008 [Polymorphisms of FAS and FASL genes and susceptibility of silicosis].
18293083 2009 Peroxisome proliferator-activated receptor gamma activates fas ligand gene promoter inducing apoptosis in human breast cancer cells.
18292515 2008 Mutation in the Fas pathway impairs CD8+ T cell memory.
18217400 2007 Concentrations of ssDNA in liver tissue and its correlation with sFas and sFasL in serum of patients infected with HBV, HCV, HCV and HIV.
18174230 2008 Association of polymorphisms in complement component C3 gene with susceptibility to systemic lupus erythematosus.
18162459 Expression and distribution of S-100 protein, CD83 and apoptosis-related proteins (Fas, FasL and Bcl-2) in thyroid tissues of autoimmune thyroid diseases.
18078642 Soluble Fas and soluble Fas ligand in the joints of patients with rheumatoid arthritis and osteoarthritis: a Tunisian case-control study.
18076022 2008 Proteasome inhibition blocks caspase-8 degradation and sensitizes prostate cancer cells to death receptor-mediated apoptosis.
18069935 2008 The sodium-dependent glucose cotransporter SLC5A11 as an autoimmune modifier gene in SLE.
18068525 2008 FAS -1377 G/A polymorphism and the risk of lymph node metastasis in cervical cancer.
18057579 2007 Aqueous humor levels of soluble Fas and Fas-ligand in patients with primary open angle and pseudoexfoliation glaucoma.
18050226 2007 Increased apoptosis of peripheral blood lymphocytes and its association with interleukin-18 in patients with active untreated adult-onset Still's disease.
18045865 2008 Amplification of CD95 activation by caspase 8-induced endosomal acidification in rat hepatocytes.
18000680 2008 Prognostic significance of the Fas-receptor/Fas-ligand system in cervical squamous cell carcinoma.
17997887 2007 [Relationship between FAS/FASL gene polymorphisms and susceptibility of coal worker's pneumoconiosis].
17969524 2007 [The expression of FasL and ICAM-1 on the HEVs in the hypertrophic tonsils].
17966039 2007 Down-regulation of Fas-ligand mRNA in Sjögren's syndrome patients with enlarged exocrine glands.
17962219 2007 Genetic polymorphisms in the apoptosis-associated genes FAS and FASL and breast cancer risk.
17961631 2008 The "Fas counterattack" is not an active mode of tumor immune evasion in colorectal cancer with high-level microsatellite instability.
17943461 2007 Myocardial Fas ligand expression increases susceptibility to AZT-induced cardiomyopathy.
17941899 2008 Antiproliferative activity of paeoniflorin is through cell cycle arrest and the Fas/Fas ligand-mediated apoptotic pathway in human non-small cell lung cancer A549 cells.
17938571 2007 Putative association of Fas and FasL gene polymorphisms with clinical outcomes of hepatitis B virus infection.
17916181 2009 Expression of Fas and Fas ligand in human testicular germ cell tumours.
17912957 2007 Inhibition of apoptosis by expression of antiapoptotic proteins in recombinant human keratinocytes.
17853317 2007 Analysis of apoptotic markers Fas/FasL (CD95/CD95L) expression on the lymphocytes in patients with acute coronary syndrome.
17823283 2007 FasL expression in hepatic antigen-presenting cells and phagocytosis of apoptotic T cells by FasL+ Kupffer cells are indicators of rejection activity in human liver allografts.
17762757 Importance of FAS-1377, FAS-670, and FASL-844 polymorphisms in tumor onset, progression, and pigment phenotypes of Swedish patients with melanoma: a case-control analysis.
17761170 2007 A proteomic screen reveals novel Fas ligand interacting proteins within nervous system Schwann cells.
17727731 2007 Association analysis of chromosome 1 migraine candidate genes.
17704746 2007 Serum levels of sFas and sFasL during chemotherapy of lung cancer.
17704118 2007 Abortion is associated with increased expression of FasL in decidual leukocytes and apoptosis of extravillous trophoblasts: a role for CRH and urocortin.
17703232 2007 Enforced covalent trimerization increases the activity of the TNF ligand family members TRAIL and CD95L.
17688234 2007 Variants of chemokine receptor 2 and interleukin 4 receptor, but not interleukin 10 or Fas ligand, increase risk of cervical cancer.
17667919 2007 Intratumoral CRH modulates immuno-escape of ovarian cancer cells through FasL regulation.
17654480 2008 Calmodulin binding to the Fas-mediated death-inducing signaling complex in cholangiocarcinoma cells.
17605793 2007 Dominant inhibition of Fas ligand-mediated apoptosis due to a heterozygous mutation associated with autoimmune lymphoproliferative syndrome (ALPS) Type Ib.
17598974 2007 Fas/Fas ligand gene polymorphism in patients with papillary thyroid cancer in the Turkish population.
17564320 2004 Soluble Fas and soluble FasL in multiple organ dysfunction syndrome complicating diffuse peritonitis.
17559541 2007 c-FLIP expression in colorectal carcinomas: association with Fas/FasL expression and prognostic implications.
17557115 2007 The Fas ligand intracellular domain is released by ADAM10 and SPPL2a cleavage in T-cells.
17545588 2007 A role for the Fas/FasL system in modulating genetic susceptibility to T-cell lymphoblastic lymphomas.
17491259 2007 [Association of FASL-844 polymorphism with the risk of idiopathic azoospermia and severe oligozoospermia].
17465232 Fas-1377A/G and FasL-844 T/C gene polymorphisms and epithelial ovarian cancer.
17381722 2007 Analysis of the -844C > T polymorphism in the promoter region of FASLgene in a cohort of Spanish HCV patients.
17290285 2007 ADAM10 regulates FasL cell surface expression and modulates FasL-induced cytotoxicity and activation-induced cell death.
17198275 2006 Disparate distribution of 16 candidate single nucleotide polymorphisms among racial and ethnic groups of pediatric heart transplant patients.
17183065 2007 Functional polymorphisms in FAS and FASL contribute to increased apoptosis of tumor infiltration lymphocytes and risk of breast cancer.
17173971 2007 Oleandrin induces apoptosis in human, but not in murine cells: dephosphorylation of Akt, expression of FasL, and alteration of membrane fluidity.
17164290 2007 Sorting of Fas ligand to secretory lysosomes is regulated by mono-ubiquitylation and phosphorylation.
17136494 2007 Engagement of CD44 up-regulates Fas ligand expression on T cells leading to activation-induced cell death.
17123604 2007 Chemokine system and tissue infiltration in aggressive NK-cell leukemia.
17123522 2007 Involvement of the Fas-Fas ligand system and active caspase-3 in abnormal apoptosis in human testes with maturation arrest and Sertoli cell-only syndrome.
17118988 2007 The human immunodeficiency virus type 1 tat protein enhances Cryptosporidium parvum-induced apoptosis in cholangiocytes via a Fas ligand-dependent mechanism.
17101499 2006 Synergistic actions of pemphigus vulgaris IgG, Fas-ligand and tumor necrosis factor-alpha during induction of basal cell shrinkage and acantholysis.
17076679 Specific isolation of placenta-derived exosomes from the circulation of pregnant women and their immunoregulatory consequences.
17071607 2006 Invasive trophoblasts stimulate vascular smooth muscle cell apoptosis by a fas ligand-dependent mechanism.
17056762 2007 Apoptosis induced in HIV-1-exposed, resting CD4+ T cells subsequent to signaling through homing receptors is Fas/Fas ligand-mediated.
17053166 2007 Increased soluble Fas plasma levels in subjects at high cardiovascular risk: Atorvastatin on Inflammatory Markers (AIM) study, a substudy of ACTFAST.
17014925 2006 Polymorphisms in the FAS and FASL genes and risk of lung cancer in a Korean population.
17008914 2007 Death receptor ligation triggers membrane scrambling between Golgi and mitochondria.
17000697 2006 Polymorphisms of FAS and FAS ligand genes involved in the death pathway and risk and progression of squamous cell carcinoma of the head and neck.
16990614 2007 Epithelial cell apoptosis by fas ligand-positive myofibroblasts in lung fibrosis.
16987075 2006 Concentrations of soluble Fas and soluble Fas ligand as indicators of programmed cell death among patients coinfected with Human Immunodeficiency Virus and Hepatitis C Virus.
16972019 2007 Elevated levels of soluble Fas (APO-1, CD95), soluble Fas ligand, and matrix metalloproteinase-3 in sera from patients with active untreated adult onset Still's disease.
16902496 2007 Membrane-bound CD95 ligand expressed on human antigen-presenting cells prevents alloantigen-specific T cell response without impairment of viral and third-party T cell immunity.
16868256 2006 Naive regulatory T cells: a novel subpopulation defined by resistance toward CD95L-mediated cell death.
16858424 2006 Fas ligand elicits a caspase-independent proinflammatory response in human keratinocytes: implications for dermatitis.
16808908 2006 Abnormal Fas/FasL and caspase-3-mediated apoptotic signaling pathways of T lymphocyte subset in patients with systemic lupus erythematosus.
16770006 2006 Competition between glucocorticoid receptor and NFkappaB for control of the human FasL promoter.
16767155 2006 CD95 ligand mediates T-cell receptor-induced apoptosis of a CD4+ CD8+ double positive thymic lymphoma.
16736614 2006 [The expression and role of Fas/FasL in infantile hemangioma].
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16691186 2006 Association of a microsatellite in FASL to type II diabetes and of the FAS-670G>A genotype to insulin resistance.
16627752 2006 A homozygous Fas ligand gene mutation in a patient causes a new type of autoimmune lymphoproliferative syndrome.
16601838 2006 Anti-angiogenesis mediated by angiostatin K1-3, K1-4 and K1-4.5. Involvement of p53, FasL, AKT and mRNA deregulation.
16595663 2006 Active transcription of the human FASL/CD95L/TNFSF6 promoter region in T lymphocytes involves chromatin remodeling: role of DNA methylation and protein acetylation suggest distinct mechanisms of transcriptional repression.
16595635 2006 The adaptor protein Nck interacts with Fas ligand: Guiding the death factor to the cytotoxic immunological synapse.
16538172 2006 Polymorphisms of the FAS and FAS ligand genes associated with risk of cutaneous malignant melanoma.
16538171 2006 Functional polymorphisms in the promoter regions of the FAS and FAS ligand genes and risk of bladder cancer in south China: a case-control analysis.
16514159 2006 Porphyromonas gingivalis enhances FasL expression via up-regulation of NFkappaB-mediated gene transcription and induces apoptotic cell death in human gingival epithelial cells.
16512757 2006 No association between selected candidate gene polymorphisms and severe chronic periodontitis.
16498403 2006 The role of receptor internalization in CD95 signaling.
16487513 2006 Dual treatment with COX-2 inhibitor and sodium arsenite leads to induction of surface Fas Ligand expression and Fas-Ligand-mediated apoptosis in human melanoma cells.
16474169 2006 Matrix metalloproteinase-7 increases resistance to Fas-mediated apoptosis and is a poor prognostic factor of patients with colorectal carcinoma.
16441482 2006 Study of Fas (CD95) and FasL (CD178) polymorphisms in liver transplant recipients.
16364925 2006 Overexpression of thymosin beta-4 renders SW480 colon carcinoma cells more resistant to apoptosis triggered by FasL and two topoisomerase II inhibitors via downregulating Fas and upregulating Survivin expression, respectively.
16332972 2006 Posttranscriptional regulation of Fas (CD95) ligand killing activity by lipid rafts.
16332967 2006 CD7-restricted activation of Fas-mediated apoptosis: a novel therapeutic approach for acute T-cell leukemia.
16318909 2006 Regulation of FasL expression: a SH3 domain containing protein family involved in the lysosomal association of FasL.
16313826 2005 [Genetic polymorphisms of apoptosis-associated genes FAS and FASL and risk of colorectal cancer].
16306044 2006 Opposite roles of FAP-1 and dynamin in the regulation of Fas (CD95) translocation to the cell surface and susceptibility to Fas ligand-mediated apoptosis.
16298578 2005 The granule exocytosis and Fas/FasLigand pathways at the time of transplantation and during borderline and acute rejection of human renal allografts.
16282344 2006 Fas ligand is localized to membrane rafts, where it displays increased cell death-inducing activity.
16273638 2005 Mechanism of counterattack of colorectal cancer cell by Fas/Fas ligand system.
16212902 2004 Distinct overexpression of Fas ligand on T lymphocytes in aplastic anemia.
16204241 2005 Binding of the intracellular Fas ligand (FasL) domain to the adaptor protein PSTPIP results in a cytoplasmic localization of FasL.
16186185 2005 FASL -844C polymorphism is associated with increased activation-induced T cell death and risk of cervical cancer.
16181301 2005 Polymorphisms in apoptosis genes predict response to infliximab therapy in luminal and fistulizing Crohn's disease.
16163374 2005 Functional promoter haplotypes of the human FAS gene are associated with the phenotype of SLE characterized by thrombocytopenia.
16158329 2005 Genetic polymorphisms of Fas (CD95) and Fas ligand (CD178) influence the rise in CD4+ T cell count after antiretroviral therapy in drug-naïve HIV-positive patients.
16157266 2005 The role of the tumor necrosis factor (TNF)--Fas L and HCV in the development of hepatocellular carcinoma.
16157125 2005 Polymorphism of Fas and Fas ligand in preterm premature rupture of membranes in singleton pregnancies.
16155003 2005 The C terminus of HIV-1 Tat modulates the extent of CD178-mediated apoptosis of T cells.
16133992 2005 Mechanisms of apoptosis of T-cells in human tuberculosis.
16124644 2005 [The expression and significance of Fas/FasL in nasal polyps tissue].
16087126 2005 Characterization of soluble FAS, FAS ligand and tumour necrosis factor-alpha in patients with chronic HCV infection.
16081306 Tumor exosomes expressing Fas ligand mediate CD8+ T-cell apoptosis.
16000573 2005 FAS/FAS ligand ratio: a marker of oxaliplatin-based intrinsic and acquired resistance in advanced colorectal cancer.
15996722 2005 Genetic polymorphisms of FAS and FASL (CD95/CD95L) genes in cervical carcinogenesis: An analysis of haplotype and gene-gene interaction.
15991293 2005 Role of cytokines in promoting immune escape of FasL-expressing human colon cancer cells.
15979995 2005 Presence of membrane and soluble forms of Fas ligand and of matrilysin (MMP-7) activity in normal and abnormal human semen.
15975999 2005 NF-kappaB regulates Fas-mediated apoptosis in HIV-associated nephropathy.
15968727 2005 Action and mechanism of Fas and Fas ligand in immune escape of gallbladder carcinoma.
15962391 2005 Fas ligand expression in colon cancer: a possible mechanism of tumor immune privilege.
15938782 2005 [Expression of Fas antigen and ligand, placental growth factor in placenta of pregnant women with pre-eclampsia].
15937082 2005 Functional polymorphisms in cell death pathway genes FAS and FASL contribute to risk of lung cancer.
15928037 2005 HIV-1 Nef-induced FasL induction and bystander killing requires p38 MAPK activation.
15907374 2005 Expression of Fas and Fas-ligand and analysis of argyrophilic nucleolar organizer regions in squamous cell carcinoma: relationships with tumor stage and grade, and apoptosis.
15870181 2005 Haploinsufficiency, rather than the effect of an excessive production of soluble CD95 (CD95{Delta}TM), is the basis for ALPS Ia in a family with duplicated 3' splice site AG in CD95 intron 5 on one allele.
15870081 2005 Diacylglycerol kinase alpha regulates the secretion of lethal exosomes bearing Fas ligand during activation-induced cell death of T lymphocytes.
15849828 2005 Transfection of apoptosis related gene Fas ligand in human hepatocellular carcinoma cells and its significance in apoptosis.
15833141 2005 Altered expression of membrane-bound and soluble CD95/Fas contributes to the resistance of fibrotic lung fibroblasts to FasL induced apoptosis.
15816832 2005 Resistance to activation-induced cell death and bystander cytotoxicity via the Fas/Fas ligand pathway are implicated in the pathogenesis of cutaneous T cell lymphomas.
15814666 2005 Fas ligand (CD178) cytoplasmic tail is a positive regulator of Fas ligand-mediated cytotoxicity.
15806311 2005 Polymorphisms in the promoter regions of FAS and FASL genes as candidate genetic factors conferring susceptibility to endometriosis.
15803113 2005 Fas/Fas-Ligand pathway is impaired in patients with type 2 diabetes. Influence of hypertension and insulin resistance.
15795317 2005 The extracellular domains of FasL and Fas are sufficient for the formation of supramolecular FasL-Fas clusters of high stability.
15791651 2005 Hibiscus polyphenol-rich extract induces apoptosis in human gastric carcinoma cells via p53 phosphorylation and p38 MAPK/FasL cascade pathway.
15694838 2005 p21 (Waf1/Cip1) and FasL gene activation via Sp1 and NFkappaB is required for leukemia cell survival but not for cell death induced by diverse stimuli.
15686714 2004 Apoptotic death of infiltrating cells in human cardiac allografts is regulated by IL-2, FASL, and FLIP.
15674374 2005 The -844C/T polymorphism in the Fas ligand promoter associates with Taiwanese SLE.
15653751 2005 Down-regulation of normal human T cell blast activation: roles of APO2L/TRAIL, FasL, and c- FLIP, Bim, or Bcl-x isoform expression.
15579659 2005 Cytoplasmic microvesicular form of Fas ligand in human early placenta: switching the tissue immune privilege hypothesis from cellular to vesicular level.
15557763 2004 Role of the receptor-mediated apoptosis in Helicobacter pylori in gastric epithelial cells.
15542843 2004 Sustained activation of p38 mitogen-activated protein kinase and c-Jun N-terminal kinase pathways by hepatitis B virus X protein mediates apoptosis via induction of Fas/FasL and tumor necrosis factor (TNF) receptor 1/TNF-alpha expression.
15492869 2004 Impaired apoptosis of lymphocytes derived from patient with decreased expression of caspase-8 results in Alps-like phenotype.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15480896 2004 Mesangial cell Fas ligand: upregulation in human lupus nephritis and NF-kappaB-mediated expression in cultured human mesangial cells.
15457562 2004 Role of soluble Fas ligand in autoimmune diseases.
15358139 2004 Co-inhibition of epidermal growth factor receptor and type 1 insulin-like growth factor receptor synergistically sensitizes human malignant glioma cells to CD95L-induced apoptosis.
15339846 2005 Fas-ligand (CD178) and TRAIL synergistically induce apoptosis of CD40-activated chronic lymphocytic leukemia B cells.
15337758 2004 Fas ligand induces cell-autonomous NF-kappaB activation and interleukin-8 production by a mechanism distinct from that of tumor necrosis factor-alpha.
15314293 2004 Vulnerability of mouse cortical neurons to doxorubicin-induced apoptosis is strain-dependent and is correlated with mRNAs encoding Fas, Fas-Ligand, and metalloproteinases.
15302589 2004 Synergistic induction of the Fas (CD95) ligand promoter by Max and NFkappaB in human non-small lung cancer cells.
15287856 2004 Serum levels of soluble molecules associated with evasion of immune surveillance: a study in biliary disease.
15277733 2004 Ongoing myocardial damage in chronic heart failure is related to activated tumor necrosis factor and Fas/Fas ligand system.
15272306 2004 CD95 ligand induces motility and invasiveness of apoptosis-resistant tumor cells.
15240787 2004 Polymorphisms of death pathway genes FAS and FASL in esophageal squamous-cell carcinoma.
15218339 2004 A study of promoter and intronic markers of ApoI/Fas gene and the interaction with Fas ligand in relapsing multiple sclerosis.
15195700 2004 Regulation of interleukin-2 induced soluble Fas ligand release from human peripheral blood mononuclear cells.
15183989 2004 c-FLIP expression in bladder urothelial carcinomas: its role in resistance to Fas-mediated apoptosis and clinicopathologic correlations.
15178561 2004 Endothelial overexpression of Fas ligand decreases atherosclerosis in apolipoprotein E-deficient mice.
15173177 2004 Hepatitis B virus X protein induces expression of Fas ligand gene through enhancing transcriptional activity of early growth response factor.
15138553 2004 Fas and Fas ligand: Expression and soluble circulating levels in bile duct carcinoma.
15093732 2004 The human melanoma cell line MelJuSo secretes bioactive FasL and APO2L/TRAIL on the surface of microvesicles. Possible contribution to tumor counterattack.
15073283 2004 Regulation of Fas ligand expression by vascular endothelial growth factor in endometrial stromal cells in vitro.
15042330 2004 Genomic analysis of Fas and FasL genes and absence of correlation with disease progression in AIDS.
15019279 2004 Expression of FasL by tumor cells does not abrogate anti-tumor CTL function.
14996347 2004 Expression of FasL and perforin/granzyme B mRNA in chronic hepatitis B virus infection.
14988839 2004 Placenta-derived CD95 ligand causes liver damage in hemolysis, elevated liver enzymes, and low platelet count syndrome.
14977837 2004 Altered expression of FAS system is related to adverse clinical outcome in stage I-II breast cancer patients treated with adjuvant anthracycline-based chemotherapy.
14967838 2004 Fas signaling induces Akt activation and upregulation of endothelial nitric oxide synthase expression.
14962292 2004 Human Fas-ligand expression on porcine endothelial cells does not protect against xenogeneic natural killer cytotoxicity.
14749367 2004 Regulation of apoptosis by the Ft1 protein, a new modulator of protein kinase B/Akt.
14739535 2004 The Fas promoter polymorphism at position -670 is not associated with late-onset sporadic Alzheimer's disease.
14739407 2004 NF-kappaB activation and Fas ligand overexpression in blood and plaques of patients with carotid atherosclerosis: potential implication in plaque instability.
14739003 2004 Fas ligand/Fas system in the brain: regulator of immune and apoptotic responses.
14705811 2003 The tolerogenic molecule CD95-L is expressed on the plasma membrane of human activated, but not resting, Langerhans' cells.
14698859 2004 CD95 polymorphisms are associated with susceptibility to MS in women. A population-based study of CD95 and CD95L in MS.
14669310 2003 Overexpression of HBxAg in hepatocellular carcinoma and its relationship with Fas/FasL system.
14668794 2003 CD95/Fas signaling in human melanoma cells: conditional expression of CD95L/FasL overcomes the intrinsic apoptosis resistance of malignant melanoma and inhibits growth and progression of human melanoma xenotransplants.
14644197 2003 Mechanisms of caspase activation.
14642527 2003 FasL-induced downregulation of CD28 expression on jurkat cells in vitro is associated with activation of caspases.
14634098 2003 Fibronectin-associated Fas ligand rapidly induces opposing and time-dependent effects on the activation and apoptosis of T cells.
14625471 2003 Regulation of Fas (APO-1, CD95) and Fas ligand expression in leukocytes during systemic inflammation in humans.
14602201 2003 Induction of FAS ligand expression in a human hepatoblastoma cell line by HCV core protein.
14560009 2003 Egr family members regulate nonlymphoid expression of Fas ligand, TRAIL, and tumor necrosis factor during immune responses.
14534535 2003 Progesterone-induced apoptosis in immortalized normal and malignant human ovarian surface epithelial cells involves enhanced expression of FasL.
14514471 2003 Expression of Fas antigen and Fas ligand in bronchoalveolar lavage from silicosis patients.
12930319 2003 Fas ligand is not constitutively expressed in low-grade B-cell lymphoma and B-lymphoblastoid cells.
12928375 2003 Human chorionic gonadotropin contributes to maternal immunotolerance and endometrial apoptosis by regulating Fas-Fas ligand system.
12923319 2003 Distinct patterns of cleavage and translocation of cell cycle control proteins in CD95-induced and p53-induced apoptosis.
12918731 2003 Soluble Fas ligand levels in cerebrospinal fluid in neuro-Behçet's disease.
12887920 2003 Induction of TNF receptor I-mediated apoptosis via two sequential signaling complexes.
12867600 2003 Soluble Fas (CD95/Apo-1), soluble Fas ligand, and activated caspase 3 in the cerebrospinal fluid of infants with posthemorrhagic and nonhemorrhagic hydrocephalus.
12854132 2003 Expression of Fas ligand and caspase-3 contributes to formation of immune escape in gastric cancer.
12849704 2003 A Bcl-2 transgene expressed in hepatocytes does not protect mice from fulminant liver destruction induced by Fas ligand.
12807917 2003 Stimulation of Kv1.3 potassium channels by death receptors during apoptosis in Jurkat T lymphocytes.
12803240 2003 Expression of Fas/Fas-ligand, Bcl-2 protein and apoptosis in extravillous trophoblast along invasion to the decidua in human term placenta.
12794109 2003 CTLA-4. FasL induces alloantigen-specific hyporesponsiveness.
12787425 2003 Regulation of apoptosis by lethal cytokines in human mesothelial cells.
12783210 2003 Involvement of Fas and TNF pathways in the induction of apoptosis of T cells by antithymocyte globulin.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12742739 2003 Fas and Fas ligand are associated with neuritic degeneration in the AD brain and participate in beta-amyloid-induced neuronal death.
12742662 2003 The development of clinical activity in relapsing-remitting MS is associated with a decrease of FasL mRNA and an increase of Fas mRNA in peripheral blood.
12717632 2003 Fas-Fas ligand (CD95-CD95L) and cytotoxic T lymphocyte antigen-4 engagement mediate T cell unresponsiveness in patients with paracoccidioidomycosis.
12710855 2003 Maternal serum of women with pre-eclampsia reduces trophoblast cell viability: evidence for an increased sensitivity to Fas-mediated apoptosis.
12707034 2003 Toxic epidermal necrolysis and Stevens-Johnson syndrome are induced by soluble Fas ligand.
12700199 2003 Regulation of FasL/Fas in human trophoblasts: possible implications for chorioamnionitis.
12698366 2003 Immunohistochemical study of the apoptotic mechanisms in the intestinal mucosa during children's coeliac disease.
12651606 2003 Human urinary bladder transitional cell carcinomas acquire the functional Fas ligand during tumor progression.
12637505 2003 Sustained activation of JNK/p38 MAPK pathways in response to cisplatin leads to Fas ligand induction and cell death in ovarian carcinoma cells.
12629150 2003 Cross-talk between tumor cells and neutrophils through the Fas (APO-1, CD95)/FasL system: human glioma cells enhance cell viability and stimulate cytokine production in neutrophils.
12618758 2003 An unexpected role for FosB in activation-induced cell death of T cells.
12594300 2003 High expression of Fas ligand by synovial fluid-derived gamma delta T cells in Lyme arthritis.
12583439 2002 Bax, Bcl-2, fas and Fas-L antigen expression in human seminoma: correlation with the apoptotic index.
12559631 2003 Fas ligand gene polymorphisms are not associated with Hashimoto's thyroiditis and Graves' disease.
12557947 2001 The role of Fas system [Fas-FasL] as an inducer of apoptosis in cutaneous leishmaniasis: a combined human and experimental study.
12515623 2002 [Fas and Fas-L expression in human adenocarcinoma of uterine cervix].
12513781 2002 [Study on expression and function of fas ligand in human myeloid leukemia cells].
12507389 2002 Possible involvement of Fas system in the induction of apoptosis in human astrocytic brain tumors.
12490654 2003 Somatostatin receptor subtype 2 sensitizes human pancreatic cancer cells to death ligand-induced apoptosis.
12482505 2002 A role for the Fas/Fas ligand apoptotic pathway in regulating myeloid progenitor cell kinetics.
12482410 Constitutive expression of the Fas receptor and its ligand in adult human bone marrow: a regulatory feedback loop for the homeostatic control of hematopoiesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12464266 2002 Identification of novel matrix metalloproteinase-7 (matrilysin) cleavage sites in murine and human Fas ligand.
12454289 2002 Nonlymphoid Fas ligand in peptide-induced peripheral lymphocyte deletion.
12421989 2002 The apoptotic ligands TRAIL, TWEAK, and Fas ligand mediate monocyte death induced by autologous lupus T cells.
12414956 2002 The human papillomavirus type 16 E5 protein impairs TRAIL- and FasL-mediated apoptosis in HaCaT cells by different mechanisms.
12414525 2002 Fas and fas ligand are up-regulated in pulmonary edema fluid and lung tissue of patients with acute lung injury and the acute respiratory distress syndrome.
12393889 2002 A novel signaling mechanism for soluble CD95 ligand. Synergy with anti-CD95 monoclonal antibodies for apoptosis and NF-kappaB nuclear translocation.
12372468 2002 Elevated soluble Fas ligand levels may suggest a role for apoptosis in women with endometriosis.
12220636 2002 The COOH-terminus of parathyroid hormone-related protein (PTHrP) interacts with beta-arrestin 1B.
12208869 2002 Vitamin E inhibits CD95 ligand expression and protects T cells from activation-induced cell death.
12201652 2002 Mechanisms of nonspecific cytotoxic cell regulation of apoptosis: cytokine-like activity of Fas ligand.
12198154 2002 Caspase-10 is recruited to and activated at the native TRAIL and CD95 death-inducing signalling complexes in a FADD-dependent manner but can not functionally substitute caspase-8.
12161534 2002 Regulation of fas ligand expression by IL-8 in human endometrium.
12137598 2002 [The role of Fas/Fas ligand in tumorgenesis, immune escape, and counterattack in colonic cancer].
12113885 Regulation of Fas ligand expression by estrogen in normal ovary.
12023017 2002 Identification of interaction partners of the cytosolic polyproline region of CD95 ligand (CD178).
12021072 2002 Differential regulation and function of the Fas/Fas ligand system in human trophoblast cells.
12009596 2002 Granzyme B, FAS-ligand and perforin expression during acute cellular rejection episodes after kidney transplantation: comparison between blood and renal aspirates.
11994542 2002 Hormonal regulation of apoptosis and the Fas and Fas ligand system in human endometrial cells.
11994433 2002 Modulation of dendritic cell differentiation and maturation by decoy receptor 3.
11965496 2002 Genetic polymorphisms of Fas (CD95) and FasL (CD178) in human longevity: studies on centenarians.
11961305 2002 Differential expressions of Fas and Fas ligand in human placenta.
11909874 2002 HIV Tat binds Egr proteins and enhances Egr-dependent transactivation of the Fas ligand promoter.
11908702 2002 Soluble Fas ligand-susceptible "memory" cells in mice but not in human: potential role of soluble Fas ligand in deletion of auto-reactive cells.
11895550 2002 Fas (Apo-1/CD95) and Fas ligand interaction between gastric cancer cells and immune cells.
11830480 2002 Negative regulation of erythroblast maturation by Fas-L(+)/TRAIL(+) highly malignant plasma cells: a major pathogenetic mechanism of anemia in multiple myeloma.
11809905 2002 Fas (CD95/Apo-1)/Fas ligand expression in neonates with pontosubicular neuron necrosis.
11788891 2002 Expression of Fas and Fas ligand in esophageal tissue mucosa and carcinomas.
11786482 2002 Sodium butyrate induces P53-independent, Fas-mediated apoptosis in MCF-7 human breast cancer cells.
11741599 2001 Multiple interactions of the cytosolic polyproline region of the CD95 ligand: hints for the reverse signal transduction capacity of a death factor.
11739488 2001 Differential secretion of Fas ligand- or APO2 ligand/TNF-related apoptosis-inducing ligand-carrying microvesicles during activation-induced death of human T cells.
11606059 2001 Apoptosis-linked gene 2 binds to the death domain of Fas and dissociates from Fas during Fas-mediated apoptosis in Jurkat cells.
11559749 2001 Fas ligand is targeted to secretory lysosomes via a proline-rich domain in its cytoplasmic tail.
11500835 2001 The membrane-bound but not the soluble form of human Fas ligand is responsible for its inflammatory activity.
11438180 2001 Association of a CA repeat polymorphism upstream of the Fas ligand gene with multiple sclerosis.
11276204 2001 Extracellular matrix interacts with soluble CD95L: retention and enhancement of cytotoxicity.
11101870 2000 Fas triggers an alternative, caspase-8-independent cell death pathway using the kinase RIP as effector molecule.
11048727 2000 The biochemistry of apoptosis.
11036836 2000 Fas and Fas ligand gene polymorphisms in primary Sjögren's syndrome.
11013215 2000 CD95 (APO-1/Fas) linkage to the actin cytoskeleton through ezrin in human T lymphocytes: a novel regulatory mechanism of the CD95 apoptotic pathway.
10671224 2000 T cell activation-induced and HIV tat-enhanced CD95(APO-1/Fas) ligand transcription involves NF-kappaB.
10630977 2000 Ionizing radiation alters Fas antigen ligand at the cell surface and on exfoliated plasma membrane-derived vesicles: implications for apoptosis and intercellular signaling.
10318773 1999 A newly identified member of tumor necrosis factor receptor superfamily (TR6) suppresses LIGHT-mediated apoptosis.
9971775 1999 Human immunodeficiency virus type 1 Tat induces apoptosis and increases sensitivity to apoptotic signals by up-regulating FLICE/caspase-8.
9872321 1998 Genomic amplification of a decoy receptor for Fas ligand in lung and colon cancer.
9721089 1998 Death receptors: signaling and modulation.
9427603 1998 Downregulation of Fas ligand by shedding.
9405425 1997 Separate domains of the human fas ligand dictate self-association and receptor binding.
9261095 1997 Characterization of the interactions between PDZ domains of the protein-tyrosine phosphatase PTPL1 and the carboxyl-terminal tail of Fas.
9228058 1997 Characterization of Fas (Apo-1, CD95)-Fas ligand interaction.
9215629 1997 Daxx, a novel Fas-binding protein that activates JNK and apoptosis.
9126929 1997 Identification of amino acid residues important for ligand binding to Fas.
9022072 1997 CD95 ligand (FasL)-induced apoptosis is necessary for corneal allograft survival.
8910274 1996 Melanoma cell expression of Fas(Apo-1/CD95) ligand: implications for tumor immune escape.
8906799 1996 Protection against Fas/APO-1- and tumor necrosis factor-mediated cell death by a novel protein, sentrin.
8787672 1996 Fas ligand mutation in a patient with systemic lupus erythematosus and lymphoproliferative disease.
8681376 1996 Involvement of MACH, a novel MORT1/FADD-interacting protease, in Fas/APO-1- and TNF receptor-induced cell death.
8521815 1995 Cytotoxicity-dependent APO-1 (Fas/CD95)-associated proteins form a death-inducing signaling complex (DISC) with the receptor.
7980502 1994 Role of Fas ligand in apoptosis induced by hepatitis C virus infection.
7826947 1994 Human Fas ligand: gene structure, chromosomal location and species specificity.
7589480 1995 Interaction of peptides derived from the Fas ligand with the Fyn-SH3 domain.
7566174 1995 A role for CD95 ligand in preventing graft rejection.
7539892 1995 Sensitization of T cells to CD95-mediated apoptosis by HIV-1 Tat and gp120.
7536190 1995 A novel protein that interacts with the death domain of Fas/APO1 contains a sequence motif related to the death domain.
7530336 1995 Cell-autonomous Fas (CD95)/Fas-ligand interaction mediates activation-induced apoptosis in T-cell hybridomas.
7528780 1995 Fas ligand mediates activation-induced cell death in human T lymphocytes.
7505205 1993 Molecular cloning and expression of the Fas ligand, a novel member of the tumor necrosis factor family.