Property Summary

NCBI Gene PubMed Count 20
PubMed Score 12.01
PubTator Score 28.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
primitive neuroectodermal tumor 1.100 4.1e-03
non primary Sjogren syndrome sicca -1.100 2.3e-02
Pick disease -1.200 2.7e-04
acute myeloid leukemia -1.200 2.0e-02

Gene RIF (3)

PMID Text
22137894 Human PheRS recognizes C74, the G1-C72 base pair, and the "discriminator" base A73, proposed to contribute to tRNA(Phe) identity in the yeast mitochondrial enzyme.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20223217 Structure of human cytosolic phenylalanyl-tRNA synthetase: evidence for kingdom-specific design of the active sites and tRNA binding patterns

AA Sequence

MPTVSVKRDLLFQALGRTYTDEEFDELCFEFGLELDEITSEKEIISKEQGNVKAAGASDVVLYKIDVPAN      1 - 70
RYDLLCLEGLVRGLQVFKERIKAPVYKRVMPDGKIQKLIITEETAKIRPFAVAAVLRNIKFTKDRYDSFI     71 - 140
ELQEKLHQNICRKRALVAIGTHDLDTLSGPFTYTAKRPSDIKFKPLNKTKEYTACELMNIYKTDNHLKHY    141 - 210
LHIIENKPLYPVIYDSNGVVLSMPPIINGDHSRITVNTRNIFIECTGTDFTKAKIVLDIIVTMFSEYCEN    211 - 280
QFTVEAAEVVFPNGKSHTFPELAYRKEMVRADLINKKVGIRETPENLAKLLTRMYLKSEVIGDGNQIEIE    281 - 350
IPPTRADIIHACDIVEDAAIAYGYNNIQMTLPKTYTIANQFPLNKLTELLRHDMAAAGFTEALTFALCSQ    351 - 420
EDIADKLGVDISATKAVHISNPKTAEFQVARTTLLPGLLKTIAANRKMPLPLKLFEISDIVIKDSNTDVG    421 - 490
AKNYRHLCAVYYNKNPGFEIIHGLLDRIMQLLDVPPGEDKGGYVIKASEGPAFFPGRCAEIFARGQSVGK    491 - 560
LGVLHPDVITKFELTMPCSSLEINVGPFL                                             561 - 589
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22137894 2012 Crystal structure of human mitochondrial PheRS complexed with tRNA(Phe) in the active "open" state.
21596488 2012 Use of germline polymorphisms in predicting concurrent chemoradiotherapy response in esophageal cancer.
21269460 2011 Initial characterization of the human central proteome.
20433702 2010 HSP60, a protein downregulated by IGFBP7 in colorectal carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20223217 2010 Structure of human cytosolic phenylalanyl-tRNA synthetase: evidence for kingdom-specific design of the active sites and tRNA binding patterns.
19946888 2010 Defining the membrane proteome of NK cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15000680 2004 Role of low-molecular-weight substrates in functional binding of the tRNAPhe acceptor end by phenylalanyl-tRNA synthetase.
14980694 2004 A series of spirocyclic analogues as potent inhibitors of bacterial phenylalanyl-tRNA synthetases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12962494 2003 Prokaryotic and eukaryotic tetrameric phenylalanyl-tRNA synthetases display conservation of the binding mode of the tRNA(Phe) CCA end.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11858721 2002 Cloning and expression of human phenylalanyl-tRNA synthetase in Escherichia coli: comparative study of purified recombinant enzymes.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10375616 1999 Cloning of the cDNA encoding phenylalanyl tRNA synthetase regulatory alpha-subunit-like protein whose expression is down-regulated during differentiation.
10049785 1999 Human phenylalanyl-tRNA synthetase: cloning, characterization of the deduced amino acid sequences in terms of the structural domains and coordinately regulated expression of the alpha and beta subunits in chronic myeloid leukemia cells.
9177188 1997 Expression of a gene encoding a tRNA synthetase-like protein is enhanced in tumorigenic human myeloid leukemia cells and is cell cycle stage- and differentiation-dependent.
1741281 1992 Recognition nucleotides for human phenylalanyl-tRNA synthetase.
658405 1978 Phenylalanyl-tRNA synthetase of the human placenta. Evidence for different enzymatic forms in equilibrium.